Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|088300
Gene name
Locationscaffold_5:2523191..2525500
Strand-
Gene length (bp)2309
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.4E-30 88 464

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 29 511 3.0E-72
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 50 522 1.0E-66
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 33 513 2.0E-63
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 10 510 1.0E-62
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 40 513 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 29 511 3.0E-72
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 50 522 1.0E-66
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 33 513 2.0E-63
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 10 510 1.0E-62
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 40 513 2.0E-61
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 10 511 3.0E-61
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 38 519 3.0E-58
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 1 507 3.0E-58
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 52 511 4.0E-58
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 29 511 2.0E-57
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 13 513 1.0E-56
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 54 511 4.0E-55
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 54 514 6.0E-55
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 42 511 2.0E-54
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 54 518 8.0E-54
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 37 515 1.0E-52
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 48 513 3.0E-49
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 39 513 1.0E-48
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 48 510 2.0E-48
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 57 516 8.0E-48
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 45 513 1.0E-45
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 45 513 4.0E-45
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 66 514 2.0E-44
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 66 514 2.0E-44
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 115 514 2.0E-39
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 1 517 4.0E-38
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 2 513 2.0E-37
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 32 520 6.0E-28
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 73 281 3.0E-13
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 26 507 4.0E-13
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 6 478 4.0E-12
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 370 513 8.0E-12
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 110 501 8.0E-11
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 5 363 2.0E-08
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 104 244 5.0E-08
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 100 262 5.0E-08
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 100 262 5.0E-08
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 100 262 5.0E-08
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 100 262 5.0E-08
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 100 262 5.0E-08
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 113 261 7.0E-08
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 100 262 7.0E-08
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 100 262 7.0E-08
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 100 262 7.0E-08
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 122 261 2.0E-07
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 100 262 2.0E-07
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 100 262 2.0E-07
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 64 477 2.0E-07
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 100 262 3.0E-07
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 372 503 3.0E-07
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 100 262 6.0E-07
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 95 314 2.0E-06
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 100 262 4.0E-06
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 101 272 5.0E-06
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 125 255 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 118 140 22
3 147 169 22
4 179 201 22
5 206 228 22
6 238 257 19
7 312 334 22
8 344 366 22
9 387 409 22
10 414 436 22
11 443 465 22
12 480 502 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|088300
MDQCSNELLRTDEEMGMAGNEFNKVELPGTPTSLVKSSDSAERLSISKEGELSENDDVIWVEFEPNDPRNPINFS
RRKKWCLTIVASISSGLASTAASAYNLGFGSMIRDLNCTEFQATVGLSVYPLGFAVVPMLTASLSEEVGRRPLYL
WTAIGYELSFVMIALAPNIQTVIAGRFLQGAFASTGATMVGGTVADIWSVAERGLPMAMFALAATICLGVGPIAG
GWIEMNPNLEWKWINWVQMTWSGAFIPAAYFVLKETRSTIVLEKIAKQMRKKTGDQRYRARVEKPKLLDLMWISC
TRPLRLVLTEPVVTSFSAWIGFLWGVLFCLLESVSGVFKTLHHFNVGQTGMVFITMSIGPLLGFATNLYQEKLYT
KYYPTRNAEARLIASCFAAFLLPIGMFIYAWCSFPEIHWISLCIGITIYMWGTFVVYLCIFSYLADCYGPYASSA
LAGQSLTRNLLAAVFPLFTQQMYNKLSYKWANTLFGCIALLMVPIPFVLFYYGPKIRMMSKFSRMAVESQKQ*
Coding >AgabiH97|088300
ATGGATCAATGTTCCAACGAGCTCCTCCGTACTGATGAAGAGATGGGTATGGCGGGAAATGAGTTTAATAAGGTC
GAGTTACCTGGTACCCCTACATCTCTAGTCAAGTCTTCTGACTCAGCTGAGCGCCTTTCGATTTCAAAAGAGGGA
GAGCTAAGTGAGAATGACGATGTCATATGGGTGGAGTTCGAGCCTAATGACCCCAGAAACCCAATCAACTTTTCT
CGACGAAAGAAATGGTGCCTCACCATTGTCGCCTCCATATCATCGGGTCTTGCTTCGACAGCTGCTTCCGCGTAC
AATCTCGGCTTTGGATCTATGATACGTGATCTCAATTGCACAGAGTTTCAAGCTACTGTCGGTCTCAGCGTGTAC
CCCCTCGGGTTCGCAGTCGTACCCATGCTCACCGCGTCACTCAGTGAAGAAGTAGGCAGAAGGCCACTATACTTA
TGGACGGCAATTGGATATGAACTTTCCTTTGTTATGATCGCATTGGCGCCTAACATACAAACAGTTATCGCTGGG
AGATTTTTACAAGGTGCTTTCGCTTCAACAGGAGCAACAATGGTTGGAGGCACGGTAGCTGATATCTGGTCCGTT
GCCGAGCGCGGTCTTCCCATGGCTATGTTTGCGCTAGCAGCAACTATTTGTCTGGGCGTGGGTCCTATCGCTGGG
GGGTGGATAGAGATGAATCCTAACCTTGAGTGGAAGTGGATAAATTGGGTGCAAATGACGTGGTCAGGTGCCTTT
ATCCCCGCGGCTTACTTCGTTCTGAAGGAGACACGATCAACCATAGTCTTAGAGAAAATCGCGAAACAAATGAGG
AAGAAGACAGGAGACCAGAGATATAGAGCTCGTGTGGAAAAGCCTAAATTACTTGACTTGATGTGGATAAGTTGT
ACCCGACCTTTACGACTAGTGTTGACCGAACCTGTTGTAACGAGTTTCAGCGCATGGATCGGTTTTCTCTGGGGG
GTACTTTTCTGTCTTCTAGAATCGGTATCTGGAGTATTCAAAACCTTGCATCATTTCAACGTTGGACAGACAGGA
ATGGTATTTATCACAATGTCTATTGGACCGCTTCTTGGATTTGCCACAAATTTGTACCAAGAGAAGCTTTATACG
AAGTATTACCCAACCCGTAACGCGGAAGCTCGTTTAATCGCTTCATGTTTCGCCGCCTTCCTTTTACCTATTGGG
ATGTTCATCTATGCATGGTGTTCGTTCCCTGAAATACATTGGATATCACTTTGCATCGGAATCACAATATATATG
TGGGGAACATTCGTTGTATATCTCTGCATTTTCTCATATCTAGCTGATTGTTACGGACCTTACGCCTCTTCGGCA
CTAGCAGGACAGTCTTTGACACGTAACCTCCTTGCGGCAGTGTTCCCACTCTTCACACAACAAATGTATAACAAA
CTGAGTTACAAGTGGGCAAATACCCTATTCGGATGTATTGCCTTACTCATGGTACCCATTCCCTTCGTATTATTT
TATTACGGACCGAAGATTAGAATGATGAGCAAGTTTTCGAGGATGGCTGTTGAGTCTCAAAAACAATGA
Transcript >AgabiH97|088300
ATGGATCAATGTTCCAACGAGCTCCTCCGTACTGATGAAGAGATGGGTATGGCGGGAAATGAGTTTAATAAGGTC
GAGTTACCTGGTACCCCTACATCTCTAGTCAAGTCTTCTGACTCAGCTGAGCGCCTTTCGATTTCAAAAGAGGGA
GAGCTAAGTGAGAATGACGATGTCATATGGGTGGAGTTCGAGCCTAATGACCCCAGAAACCCAATCAACTTTTCT
CGACGAAAGAAATGGTGCCTCACCATTGTCGCCTCCATATCATCGGGTCTTGCTTCGACAGCTGCTTCCGCGTAC
AATCTCGGCTTTGGATCTATGATACGTGATCTCAATTGCACAGAGTTTCAAGCTACTGTCGGTCTCAGCGTGTAC
CCCCTCGGGTTCGCAGTCGTACCCATGCTCACCGCGTCACTCAGTGAAGAAGTAGGCAGAAGGCCACTATACTTA
TGGACGGCAATTGGATATGAACTTTCCTTTGTTATGATCGCATTGGCGCCTAACATACAAACAGTTATCGCTGGG
AGATTTTTACAAGGTGCTTTCGCTTCAACAGGAGCAACAATGGTTGGAGGCACGGTAGCTGATATCTGGTCCGTT
GCCGAGCGCGGTCTTCCCATGGCTATGTTTGCGCTAGCAGCAACTATTTGTCTGGGCGTGGGTCCTATCGCTGGG
GGGTGGATAGAGATGAATCCTAACCTTGAGTGGAAGTGGATAAATTGGGTGCAAATGACGTGGTCAGGTGCCTTT
ATCCCCGCGGCTTACTTCGTTCTGAAGGAGACACGATCAACCATAGTCTTAGAGAAAATCGCGAAACAAATGAGG
AAGAAGACAGGAGACCAGAGATATAGAGCTCGTGTGGAAAAGCCTAAATTACTTGACTTGATGTGGATAAGTTGT
ACCCGACCTTTACGACTAGTGTTGACCGAACCTGTTGTAACGAGTTTCAGCGCATGGATCGGTTTTCTCTGGGGG
GTACTTTTCTGTCTTCTAGAATCGGTATCTGGAGTATTCAAAACCTTGCATCATTTCAACGTTGGACAGACAGGA
ATGGTATTTATCACAATGTCTATTGGACCGCTTCTTGGATTTGCCACAAATTTGTACCAAGAGAAGCTTTATACG
AAGTATTACCCAACCCGTAACGCGGAAGCTCGTTTAATCGCTTCATGTTTCGCCGCCTTCCTTTTACCTATTGGG
ATGTTCATCTATGCATGGTGTTCGTTCCCTGAAATACATTGGATATCACTTTGCATCGGAATCACAATATATATG
TGGGGAACATTCGTTGTATATCTCTGCATTTTCTCATATCTAGCTGATTGTTACGGACCTTACGCCTCTTCGGCA
CTAGCAGGACAGTCTTTGACACGTAACCTCCTTGCGGCAGTGTTCCCACTCTTCACACAACAAATGTATAACAAA
CTGAGTTACAAGTGGGCAAATACCCTATTCGGATGTATTGCCTTACTCATGGTACCCATTCCCTTCGTATTATTT
TATTACGGACCGAAGATTAGAATGATGAGCAAGTTTTCGAGGATGGCTGTTGAGTCTCAAAAACAATGA
Gene >AgabiH97|088300
ATGGATCAATGTTCCAACGAGCTCCTCCGTACTGATGAAGAGATGGGTATGGCGGGAAATGAGTTTAATAAGGTC
GAGTTACCTGGTACCCCTACATCTCTAGTCAAGTCTTCTGAGTGAGTATCTGCACCCGAGAAGTTTGATTCTCAT
TCTAATGAATGGACCGGACCACCCAGCTCAGCTGAGCGCCTTTCGATTTCAAAAGAGGGAGAGCTAAGTGAGAAT
GACGATGTCATATGGGTTTGAAAATGGCTCCTGCTCCGGCCGCATTCTTTACTCACGCTTCAGATTATACTCTAG
GTGGAGTTCGAGCCTAATGACCCCAGAAACCCAATCAACTTTTCTCGACGAAAGAAATGGTGCCTCACCATTGTC
GCCTCCATATCATCGGGTCTTGCTTGTGCGTTATCTGCTTCCTGCTCTTTGCCACTGTTCATAGCTTACCCATGA
ACTGTTAATCCGAATCTTTAGCGACAGCTGCTTCCGCGTACAATCTCGGCTTTGGATCTATGATACGTGATCTCA
ATTGCACAGAGTTTCAAGCTACTGTCGGTCTCAGCGTGTACCCCCTCGGGTTCGCAGTCGTACCCATGCTCACCG
CGTCACTCAGTGAAGAAGTAGGCAGAAGGCCACTATACTTATGGACGGCAATTGGATATGAACTTTCCTTTGTTA
TGATCGCATTGTGCGTTTGTGTTTCGGTGTTTGATAGATAATGTCTGCTTATCTTGATTGGCAGGGCGCCTAACA
TACAAACAGTTATCGCTGGGAGATTTTTACAAGGTGCTTTCGCTTCAACAGGAGCAACAATGGTTGGAGGCACGG
TAGCTGATATCTGGTCCGTTGCCGAGTACGTAAAATTTATGCAGATTCTAGCCAGTTCCTAATAATAAAACGACA
GGCGCGGTCTTCCCATGGCTATGTTTGCGCTAGCAGCAACTATTTGTCTGGGCGTGGGTCCTATCGCTGGGGGGT
GGATAGAGATGAATCCTAACCTTGAGTGGAAGTGGATAAATTGGGTGCAAATGACGTGGGTTCTTTCCTACCTCC
AATAATGTGTTCTTGATCAACGATGTCGTTCCTTGCTGTCATCAGGTGGTCAGGTGCCTTTATCCCCGCGGCTTA
CTTCGTTCTGAAGGAGACACGATCAACCATAGTCTTAGAGAAAATCGCGAAACAAATGAGGAAGAAGACAGGAGA
CCAGAGATATAGAGCTCGTGTGGAAAAGCCTAAATTACTTGACTTGATGTGGATAAGTTGTACCCGACCTTTACG
TGAATCTCCGTGCTTCATACCTTGGTTGTTCACTGCTAACATTATAATCACAGGACTAGTGTTGACCGAACCTGT
TGTAACGAGTTTCAGCGTGGGTATCCAACCTGCATGAGGAAGAGAAAATCCTTTAATCTTCTCTTTTTTTAGGCA
TGGATCGGTTTTCTCTGGGGGGTACTTTTCTGTCTTCTAGAATCGGTATCTGGAGTATTCAAAACCTTGCATCAT
TTCAACGTTGGACAGACAGGAATGGTATTTATCACAATGTCGTATGTGTTGAATTCAGTTTTGTTTCTCTCTGTT
CACGTCCTTCTAGTATTGGACCGCTTCTTGGATTTGCCACAAATTTGTACCAAGAGAAGCTTTATACGTAGGTCT
CAAGCGCATTAAGTTCAACTTGCCTGAATTCATAAAAAATTAGGAAGTATTACCCAACCCGTAACGCGGAAGCTC
GTTTAATCGCTTCATGTTTCGCCGCCTTCCTTTTACCTATTGGGATGTTCATCTATGCATGGTGTTCGTTCCCTG
AAATACATTGGATATCACTTTGCATCGGAATCACAGTATGTGTCTTTCATTCTTCTAAACATCCCATAAACTGAC
TCTGCTCCCTTCACATCAGATATATATGTGGGGAACATTCGTTGTATATCTCTGCATTTTCTCATATCTAGCTGA
TTGGTATGTTTTTAAACAATTTTCGTTGTCCCAAGTATCGGCTAAGGAAATCTAGTTACGGACCTTACGCCTCTT
CGGCACTAGCAGGACAGTCTTTGACACGTAACCTCCTTGCGGCAGTGTTCCCACTCTTCACACAACAAATGTATA
ACAAACTGAGTTACAAGTGGGCAAATACCCTATTCGGATGTATTGCCTTACTCATGGTACCCATTCCCTTCGTAA
GTGCCTTCTTCTAAGCGTTTCATATAAATGACTTAATCTGAGCTGGGTTGTTTCAGGTATTATTTTATTACGGAC
CGAAGATTAGAATGATGAGCAAGTTTTCGAGGATGGCTGTTGAGTCTCAAAAACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail