Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|088280
Gene name
Locationscaffold_5:2516816..2521912
Strand-
Gene length (bp)5096
Transcript length (bp)4416
Coding sequence length (bp)4416
Protein length (aa) 1472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 4.3E-58 1253 1455
PF00168 C2 C2 domain 1.5E-13 384 473
PF00168 C2 C2 domain 2.9E-16 715 811

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 1069 1470 3.0E-135
sp|P53037|PSD2_YEAST Phosphatidylserine decarboxylase proenzyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD2 PE=1 SV=1 1092 1463 9.0E-102
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 1092 1464 7.0E-95
sp|Q5JN42|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 1092 1467 4.0E-92
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 1092 1467 4.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 1069 1470 3.0E-135
sp|P53037|PSD2_YEAST Phosphatidylserine decarboxylase proenzyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD2 PE=1 SV=1 1092 1463 9.0E-102
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 1092 1464 7.0E-95
sp|Q5JN42|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 1092 1467 4.0E-92
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 1092 1467 4.0E-90
sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 1171 1463 4.0E-56
sp|A8MJ83|PSD_ALKOO Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 1170 1463 1.0E-50
sp|A0Q3R9|PSD_CLONN Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 1219 1463 6.0E-49
sp|Q9PLM7|PSD_CHLMU Phosphatidylserine decarboxylase proenzyme OS=Chlamydia muridarum (strain MoPn / Nigg) GN=psd PE=3 SV=1 1229 1463 5.0E-47
sp|Q9Z767|PSD_CHLPN Phosphatidylserine decarboxylase proenzyme OS=Chlamydia pneumoniae GN=psd PE=3 SV=1 1225 1467 9.0E-47
sp|B8I6U9|PSD_CLOCE Phosphatidylserine decarboxylase proenzyme OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=psd PE=3 SV=1 1166 1463 3.0E-46
sp|Q899T7|PSD_CLOTE Phosphatidylserine decarboxylase proenzyme OS=Clostridium tetani (strain Massachusetts / E88) GN=psd PE=3 SV=1 1221 1463 3.0E-44
sp|Q0SWT6|PSD_CLOPS Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain SM101 / Type A) GN=psd PE=3 SV=1 1221 1463 4.0E-44
sp|Q5L4W1|PSD_CHLAB Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=psd PE=3 SV=1 1229 1467 5.0E-44
sp|Q24UV7|PSD_DESHY Phosphatidylserine decarboxylase proenzyme OS=Desulfitobacterium hafniense (strain Y51) GN=psd PE=3 SV=1 1187 1468 5.0E-44
sp|Q821L3|PSD_CHLCV Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila caviae (strain GPIC) GN=psd PE=3 SV=1 1225 1467 6.0E-44
sp|Q0TV39|PSD_CLOP1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=psd PE=3 SV=1 1221 1463 6.0E-44
sp|B0BAF4|PSD_CHLTB Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=psd PE=3 SV=1 1166 1463 7.0E-44
sp|P0CD79|PSD_CHLTR Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=psd PE=3 SV=1 1166 1463 8.0E-44
sp|Q3KKZ5|PSD_CHLTA Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=psd PE=3 SV=1 1166 1463 8.0E-44
sp|B0B8S5|PSD_CHLT2 Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=psd PE=3 SV=1 1166 1463 8.0E-44
sp|Q8XPD5|PSD_CLOPE Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain 13 / Type A) GN=psd PE=3 SV=1 1221 1463 2.0E-43
sp|B8FQ96|PSD_DESHD Phosphatidylserine decarboxylase proenzyme OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=psd PE=3 SV=1 1187 1464 2.0E-42
sp|Q97N08|PSD1_CLOAB Phosphatidylserine decarboxylase proenzyme 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=psd1 PE=3 SV=1 1210 1463 5.0E-42
sp|Q256C9|PSD_CHLFF Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila felis (strain Fe/C-56) GN=psd PE=3 SV=1 1229 1463 2.0E-41
sp|A5N497|PSD_CLOK5 Phosphatidylserine decarboxylase proenzyme OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=psd PE=3 SV=1 1170 1464 2.0E-41
sp|B9DXW5|PSD_CLOK1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium kluyveri (strain NBRC 12016) GN=psd PE=3 SV=1 1170 1464 2.0E-41
sp|B2THF2|PSD_CLOBB Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=psd PE=3 SV=1 1166 1463 6.0E-41
sp|B2UX63|PSD_CLOBA Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=psd PE=3 SV=1 1166 1463 4.0E-40
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 609 934 1.0E-38
sp|A7G9C7|PSD_CLOBL Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=psd PE=3 SV=1 1217 1463 2.0E-38
sp|A6LPC8|PSD_CLOB8 Phosphatidylserine decarboxylase proenzyme OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=psd PE=3 SV=1 1166 1463 7.0E-38
sp|A5HXS0|PSD_CLOBH Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=psd PE=3 SV=1 1217 1464 1.0E-37
sp|A7FQ59|PSD_CLOB1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=psd PE=3 SV=1 1217 1464 1.0E-37
sp|Q46192|PSD_CLOPA Phosphatidylserine decarboxylase proenzyme OS=Clostridium pasteurianum GN=psd PE=3 SV=1 1170 1463 8.0E-36
sp|C3KXS2|PSD_CLOB6 Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain 657 / Type Ba4) GN=psd PE=3 SV=1 1225 1463 8.0E-36
sp|C1FPI8|PSD_CLOBJ Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Kyoto / Type A2) GN=psd PE=3 SV=1 1217 1463 2.0E-35
sp|B1L1M1|PSD_CLOBM Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=psd PE=3 SV=1 1217 1463 2.0E-35
sp|Q21H90|PSD_SACD2 Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 1229 1463 3.0E-32
sp|Q97KW7|PSD2_CLOAB Phosphatidylserine decarboxylase proenzyme 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=psd2 PE=3 SV=1 1165 1463 7.0E-31
sp|Q2SBA8|PSD_HAHCH Phosphatidylserine decarboxylase proenzyme OS=Hahella chejuensis (strain KCTC 2396) GN=psd PE=3 SV=1 1229 1463 5.0E-30
sp|C0Z4E2|PSD_BREBN Phosphatidylserine decarboxylase proenzyme OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=psd PE=3 SV=1 1222 1440 6.0E-30
sp|Q5KWX3|PSD_GEOKA Phosphatidylserine decarboxylase proenzyme OS=Geobacillus kaustophilus (strain HTA426) GN=psd PE=3 SV=1 1229 1441 1.0E-29
sp|C5D4W6|PSD_GEOSW Phosphatidylserine decarboxylase proenzyme OS=Geobacillus sp. (strain WCH70) GN=psd PE=3 SV=1 1211 1467 1.0E-29
sp|B7GKA2|PSD_ANOFW Phosphatidylserine decarboxylase proenzyme OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=psd PE=3 SV=1 1229 1471 2.0E-29
sp|Q1D614|PSD_MYXXD Phosphatidylserine decarboxylase proenzyme OS=Myxococcus xanthus (strain DK 1622) GN=psd PE=3 SV=1 1222 1464 3.0E-29
sp|A7GT32|PSD_BACCN Phosphatidylserine decarboxylase proenzyme OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=psd PE=3 SV=1 1229 1438 2.0E-28
sp|A1JIQ6|PSD_YERE8 Phosphatidylserine decarboxylase proenzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=psd PE=3 SV=1 1229 1438 6.0E-28
sp|A3QAD1|PSD_SHELP Phosphatidylserine decarboxylase proenzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=psd PE=3 SV=1 1229 1438 3.0E-27
sp|A7MZ50|PSD_VIBCB Phosphatidylserine decarboxylase proenzyme OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=psd PE=3 SV=1 1229 1452 3.0E-27
sp|B6EMR5|PSD_ALISL Phosphatidylserine decarboxylase proenzyme OS=Aliivibrio salmonicida (strain LFI1238) GN=psd PE=3 SV=1 1229 1444 4.0E-27
sp|Q5QVW0|PSD_IDILO Phosphatidylserine decarboxylase proenzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=psd PE=3 SV=1 1229 1444 7.0E-27
sp|B4S0J5|PSD_ALTMD Phosphatidylserine decarboxylase proenzyme OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=psd PE=3 SV=1 1229 1442 9.0E-27
sp|A0KSQ8|PSD_SHESA Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain ANA-3) GN=psd PE=3 SV=1 1229 1438 1.0E-26
sp|Q0HR33|PSD_SHESR Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-7) GN=psd PE=3 SV=1 1229 1438 2.0E-26
sp|Q0HMP8|PSD_SHESM Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-4) GN=psd PE=3 SV=1 1229 1438 2.0E-26
sp|A9L3W8|PSD_SHEB9 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS195) GN=psd PE=3 SV=1 1229 1438 2.0E-26
sp|A6WSW1|PSD_SHEB8 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS185) GN=psd PE=3 SV=1 1229 1438 2.0E-26
sp|A3D015|PSD_SHEB5 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=psd PE=3 SV=1 1229 1438 2.0E-26
sp|B8ECB2|PSD_SHEB2 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS223) GN=psd PE=3 SV=1 1229 1438 2.0E-26
sp|A1RFQ8|PSD_SHESW Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain W3-18-1) GN=psd PE=3 SV=1 1229 1438 3.0E-26
sp|Q5E2C0|PSD_VIBF1 Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=psd PE=3 SV=1 1229 1444 3.0E-26
sp|B0TU73|PSD_SHEHH Phosphatidylserine decarboxylase proenzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=psd PE=3 SV=1 1232 1438 3.0E-26
sp|B2VCV2|PSD_ERWT9 Phosphatidylserine decarboxylase proenzyme OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=psd PE=3 SV=1 1229 1452 4.0E-26
sp|Q7MGZ5|PSD_VIBVY Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain YJ016) GN=psd PE=3 SV=1 1229 1452 4.0E-26
sp|Q8DCV8|PSD_VIBVU Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain CMCP6) GN=psd PE=3 SV=1 1229 1452 4.0E-26
sp|B5FBS2|PSD_VIBFM Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain MJ11) GN=psd PE=3 SV=1 1229 1444 4.0E-26
sp|Q87KZ9|PSD_VIBPA Phosphatidylserine decarboxylase proenzyme OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=psd PE=3 SV=1 1229 1441 4.0E-26
sp|Q1LSP9|PSD_BAUCH Phosphatidylserine decarboxylase proenzyme OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=psd PE=3 SV=1 1229 1468 5.0E-26
sp|Q9KDA3|PSD_BACHD Phosphatidylserine decarboxylase proenzyme OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=psd PE=3 SV=1 1229 1466 5.0E-26
sp|A4YAL8|PSD_SHEPC Phosphatidylserine decarboxylase proenzyme OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=psd PE=3 SV=1 1229 1438 6.0E-26
sp|Q47C25|PSD_DECAR Phosphatidylserine decarboxylase proenzyme OS=Dechloromonas aromatica (strain RCB) GN=psd PE=3 SV=1 1229 1443 6.0E-26
sp|Q2L0K8|PSD_BORA1 Phosphatidylserine decarboxylase proenzyme OS=Bordetella avium (strain 197N) GN=psd PE=3 SV=1 1229 1448 1.0E-25
sp|Q6HDI5|PSD_BACHK Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=psd PE=3 SV=1 1229 1444 1.0E-25
sp|A1SA30|PSD_SHEAM Phosphatidylserine decarboxylase proenzyme OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=psd PE=3 SV=1 1229 1438 2.0E-25
sp|Q3IFN3|PSD_PSEHT Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=psd PE=3 SV=2 1229 1459 2.0E-25
sp|C3LR71|PSD_VIBCM Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain M66-2) GN=psd PE=3 SV=1 1229 1444 3.0E-25
sp|Q9KV19|PSD_VIBCH Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=psd PE=3 SV=1 1229 1444 3.0E-25
sp|A5F3N7|PSD_VIBC3 Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=psd PE=3 SV=1 1229 1444 3.0E-25
sp|Q6D035|PSD_PECAS Phosphatidylserine decarboxylase proenzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=psd PE=3 SV=1 1229 1459 3.0E-25
sp|C1ESN2|PSD_BACC3 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain 03BB102) GN=psd PE=3 SV=1 1229 1444 4.0E-25
sp|A0RIV4|PSD_BACAH Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis (strain Al Hakam) GN=psd PE=3 SV=1 1229 1444 4.0E-25
sp|Q730J7|PSD_BACC1 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=psd PE=3 SV=2 1229 1444 5.0E-25
sp|Q6F6W3|PSD_ACIAD Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 1238 1447 6.0E-25
sp|A1U4D6|PSD_MARHV Phosphatidylserine decarboxylase proenzyme OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=psd PE=3 SV=1 1229 1441 7.0E-25
sp|B1JMP9|PSD_YERPY Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|Q66FC4|PSD_YERPS Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|A4TRP9|PSD_YERPP Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis (strain Pestoides F) GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|Q1CEE6|PSD_YERPN Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|A9QYP0|PSD_YERPG Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Angola) GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|Q8ZIX1|PSD_YERPE Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|B2K1Z5|PSD_YERPB Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|Q1C0Z1|PSD_YERPA Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|A7FMY9|PSD_YERP3 Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=psd PE=3 SV=1 1229 1444 7.0E-25
sp|A8H8H5|PSD_SHEPA Phosphatidylserine decarboxylase proenzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=psd PE=3 SV=1 1232 1438 8.0E-25
sp|Q1Q8K8|PSD_PSYCK Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 1229 1463 1.0E-24
sp|Q5ZRA9|PSD_LEGPH Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=psd PE=3 SV=1 1229 1452 1.0E-24
sp|A9MFQ0|PSD_SALAR Phosphatidylserine decarboxylase proenzyme OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=psd PE=3 SV=1 1229 1444 1.0E-24
sp|Q634K5|PSD_BACCZ Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ZK / E33L) GN=psd PE=3 SV=1 1229 1438 2.0E-24
sp|Q121P6|PSD_POLSJ Phosphatidylserine decarboxylase proenzyme OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=psd PE=3 SV=1 1225 1443 2.0E-24
sp|B7IYJ1|PSD_BACC2 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain G9842) GN=psd PE=3 SV=1 1229 1444 2.0E-24
sp|A9KEZ8|PSD_COXBN Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain Dugway 5J108-111) GN=psd PE=3 SV=1 1229 1443 3.0E-24
sp|Q31H64|PSD_THICR Phosphatidylserine decarboxylase proenzyme OS=Thiomicrospira crunogena (strain XCL-2) GN=psd PE=3 SV=2 1229 1438 3.0E-24
sp|A8AMN8|PSD_CITK8 Phosphatidylserine decarboxylase proenzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=psd PE=3 SV=1 1229 1444 3.0E-24
sp|Q83AQ4|PSD_COXBU Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=psd PE=3 SV=1 1229 1443 4.0E-24
sp|A9NAS0|PSD_COXBR Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=psd PE=3 SV=1 1229 1443 4.0E-24
sp|B6J316|PSD_COXB2 Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuG_Q212) GN=psd PE=3 SV=1 1229 1443 4.0E-24
sp|B6J9C5|PSD_COXB1 Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuK_Q154) GN=psd PE=3 SV=1 1229 1443 4.0E-24
sp|B8F658|PSD_HAEPS Phosphatidylserine decarboxylase proenzyme OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=psd PE=3 SV=1 1229 1444 4.0E-24
sp|B5F377|PSD_SALA4 Phosphatidylserine decarboxylase proenzyme OS=Salmonella agona (strain SL483) GN=psd PE=3 SV=1 1229 1459 4.0E-24
sp|Q81LP7|PSD_BACAN Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis GN=psd PE=3 SV=1 1229 1444 4.0E-24
sp|C3L5U2|PSD_BACAC Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=psd PE=3 SV=1 1229 1444 4.0E-24
sp|C3P929|PSD_BACAA Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain A0248) GN=psd PE=3 SV=1 1229 1444 4.0E-24
sp|Q5X0Q0|PSD_LEGPA Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Paris) GN=psd PE=3 SV=1 1229 1452 4.0E-24
sp|A8A7Q7|PSD_ECOHS Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O9:H4 (strain HS) GN=psd PE=3 SV=1 1229 1444 4.0E-24
sp|C0Q6C0|PSD_SALPC Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi C (strain RKS4594) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|Q5WSH5|PSD_LEGPL Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Lens) GN=psd PE=3 SV=1 1229 1452 5.0E-24
sp|Q9EV04|PSD_DICD3 Phosphatidylserine decarboxylase proenzyme OS=Dickeya dadantii (strain 3937) GN=psd PE=3 SV=2 1229 1459 5.0E-24
sp|Q1R397|PSD_ECOUT Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain UTI89 / UPEC) GN=psd PE=3 SV=1 1229 1444 5.0E-24
sp|B7MKW7|PSD_ECO45 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=psd PE=3 SV=1 1229 1444 5.0E-24
sp|B1KHV8|PSD_SHEWM Phosphatidylserine decarboxylase proenzyme OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=psd PE=3 SV=1 1229 1438 5.0E-24
sp|Q8ZKB1|PSD_SALTY Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|B4TSE2|PSD_SALSV Phosphatidylserine decarboxylase proenzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|B5BKH1|PSD_SALPK Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain AKU_12601) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|A9N419|PSD_SALPB Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|Q5PLG9|PSD_SALPA Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|B4T2Q7|PSD_SALNS Phosphatidylserine decarboxylase proenzyme OS=Salmonella newport (strain SL254) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|B4TF96|PSD_SALHS Phosphatidylserine decarboxylase proenzyme OS=Salmonella heidelberg (strain SL476) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|B5R9A9|PSD_SALG2 Phosphatidylserine decarboxylase proenzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|B5R023|PSD_SALEP Phosphatidylserine decarboxylase proenzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|B5FRL8|PSD_SALDC Phosphatidylserine decarboxylase proenzyme OS=Salmonella dublin (strain CT_02021853) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|Q57GM9|PSD_SALCH Phosphatidylserine decarboxylase proenzyme OS=Salmonella choleraesuis (strain SC-B67) GN=psd PE=3 SV=1 1229 1459 5.0E-24
sp|A5IIH5|PSD_LEGPC Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Corby) GN=psd PE=3 SV=1 1229 1452 5.0E-24
sp|B7LLU4|PSD_ESCF3 Phosphatidylserine decarboxylase proenzyme OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=psd PE=3 SV=1 1229 1444 5.0E-24
sp|B7NTL9|PSD_ECO7I Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=psd PE=3 SV=1 1229 1444 5.0E-24
sp|B7HPN7|PSD_BACC7 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH187) GN=psd PE=3 SV=1 1229 1444 5.0E-24
sp|B7JNX0|PSD_BACC0 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH820) GN=psd PE=3 SV=1 1229 1444 5.0E-24
sp|P0A8K4|PSD_SHIFL Phosphatidylserine decarboxylase proenzyme OS=Shigella flexneri GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|Q0SXB9|PSD_SHIF8 Phosphatidylserine decarboxylase proenzyme OS=Shigella flexneri serotype 5b (strain 8401) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|Q31T93|PSD_SHIBS Phosphatidylserine decarboxylase proenzyme OS=Shigella boydii serotype 4 (strain Sb227) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|B2TY38|PSD_SHIB3 Phosphatidylserine decarboxylase proenzyme OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|B1LQI3|PSD_ECOSM Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|B6I267|PSD_ECOSE Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain SE11) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|B7NG97|PSD_ECOLU Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|P0A8K1|PSD_ECOLI Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12) GN=psd PE=1 SV=1 1229 1444 6.0E-24
sp|B1IT43|PSD_ECOLC Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|P0A8K2|PSD_ECOL6 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|Q0T9N1|PSD_ECOL5 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|B1XDR4|PSD_ECODH Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12 / DH10B) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|C5A1F4|PSD_ECOBW Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|B7M8S3|PSD_ECO8A Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O8 (strain IAI1) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|B7MSX5|PSD_ECO81 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O81 (strain ED1a) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|B5Z2G9|PSD_ECO5E Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|P0A8K3|PSD_ECO57 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O157:H7 GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|A7ZV31|PSD_ECO24 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|Q3YUI0|PSD_SHISS Phosphatidylserine decarboxylase proenzyme OS=Shigella sonnei (strain Ss046) GN=psd PE=3 SV=1 1229 1444 6.0E-24
sp|Q328E0|PSD_SHIDS Phosphatidylserine decarboxylase proenzyme OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=psd PE=3 SV=1 1229 1444 7.0E-24
sp|Q8Z194|PSD_SALTI Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhi GN=psd PE=3 SV=1 1229 1459 8.0E-24
sp|B7UPY0|PSD_ECO27 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=psd PE=3 SV=1 1229 1444 9.0E-24
sp|Q07XV9|PSD_SHEFN Phosphatidylserine decarboxylase proenzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=psd PE=3 SV=1 1229 1438 1.0E-23
sp|Q6LM21|PSD_PHOPR Phosphatidylserine decarboxylase proenzyme OS=Photobacterium profundum GN=psd PE=3 SV=1 1213 1444 1.0E-23
sp|Q818C6|PSD_BACCR Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=psd PE=3 SV=1 1229 1444 1.0E-23
sp|B7HCW5|PSD_BACC4 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain B4264) GN=psd PE=3 SV=1 1229 1444 1.0E-23
sp|A1VUQ1|PSD_POLNA Phosphatidylserine decarboxylase proenzyme OS=Polaromonas naphthalenivorans (strain CJ2) GN=psd PE=3 SV=1 1225 1443 1.0E-23
sp|Q2YB83|PSD_NITMU Phosphatidylserine decarboxylase proenzyme OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=psd PE=3 SV=1 1229 1441 2.0E-23
sp|B7LC21|PSD_ECO55 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain 55989 / EAEC) GN=psd PE=3 SV=1 1229 1444 2.0E-23
sp|A2SJL1|PSD_METPP Phosphatidylserine decarboxylase proenzyme OS=Methylibium petroleiphilum (strain PM1) GN=psd PE=3 SV=1 1229 1441 3.0E-23
sp|Q4FQD5|PSD_PSYA2 Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 1229 1440 3.0E-23
sp|A9VHW5|PSD_BACWK Phosphatidylserine decarboxylase proenzyme OS=Bacillus weihenstephanensis (strain KBAB4) GN=psd PE=3 SV=1 1229 1444 4.0E-23
sp|A6TH77|PSD_KLEP7 Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=psd PE=3 SV=1 1229 1438 4.0E-23
sp|Q0AAC1|PSD_ALKEH Phosphatidylserine decarboxylase proenzyme OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=psd PE=3 SV=1 1229 1431 5.0E-23
sp|Q2NW88|PSD_SODGM Phosphatidylserine decarboxylase proenzyme OS=Sodalis glossinidius (strain morsitans) GN=psd PE=3 SV=1 1229 1444 5.0E-23
sp|A9IM91|PSD_BORPD Phosphatidylserine decarboxylase proenzyme OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=psd PE=3 SV=1 1229 1456 6.0E-23
sp|A7MMA5|PSD_CROS8 Phosphatidylserine decarboxylase proenzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=psd PE=3 SV=1 1229 1444 7.0E-23
sp|A8FRC6|PSD_SHESH Phosphatidylserine decarboxylase proenzyme OS=Shewanella sediminis (strain HAW-EB3) GN=psd PE=3 SV=1 1229 1438 1.0E-22
sp|B5Y342|PSD_KLEP3 Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae (strain 342) GN=psd PE=3 SV=1 1229 1438 1.0E-22
sp|A4G529|PSD_HERAR Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 1229 1441 2.0E-22
sp|P43789|PSD_HAEIN Phosphatidylserine decarboxylase proenzyme OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=psd PE=3 SV=1 1229 1447 2.0E-22
sp|Q7WIF7|PSD_BORBR Phosphatidylserine decarboxylase proenzyme OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=psd PE=3 SV=1 1229 1440 2.0E-22
sp|Q7VYM4|PSD_BORPE Phosphatidylserine decarboxylase proenzyme OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=psd PE=3 SV=1 1229 1440 2.0E-22
sp|Q7W6I5|PSD_BORPA Phosphatidylserine decarboxylase proenzyme OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=psd PE=3 SV=2 1229 1440 2.0E-22
sp|B1JAE9|PSD_PSEPW Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain W619) GN=psd PE=3 SV=1 1232 1444 2.0E-22
sp|A1SZV9|PSD_PSYIN Phosphatidylserine decarboxylase proenzyme OS=Psychromonas ingrahamii (strain 37) GN=psd PE=3 SV=1 1229 1444 2.0E-22
sp|Q608T0|PSD_METCA Phosphatidylserine decarboxylase proenzyme OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=psd PE=3 SV=1 1229 1468 3.0E-22
sp|Q7P0H6|PSD_CHRVO Phosphatidylserine decarboxylase proenzyme OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=psd PE=3 SV=1 1229 1441 3.0E-22
sp|B0VP52|PSD_ACIBS Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain SDF) GN=psd PE=3 SV=1 1250 1463 3.0E-22
sp|B2FP04|PSD_STRMK Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain K279a) GN=psd PE=3 SV=1 1207 1432 3.0E-22
sp|B4SQW4|PSD_STRM5 Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain R551-3) GN=psd PE=3 SV=1 1207 1432 4.0E-22
sp|Q88DB9|PSD_PSEPK Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain KT2440) GN=psd PE=3 SV=1 1232 1444 5.0E-22
sp|A5W9U4|PSD_PSEP1 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=psd PE=3 SV=1 1232 1444 6.0E-22
sp|Q4QP27|PSD_HAEI8 Phosphatidylserine decarboxylase proenzyme OS=Haemophilus influenzae (strain 86-028NP) GN=psd PE=3 SV=1 1250 1447 7.0E-22
sp|A4XPX3|PSD_PSEMY Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas mendocina (strain ymp) GN=psd PE=3 SV=1 1229 1444 7.0E-22
sp|B0KL10|PSD_PSEPG Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain GB-1) GN=psd PE=3 SV=1 1232 1444 7.0E-22
sp|A3MA23|PSD_ACIBT Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=psd PE=3 SV=2 1250 1463 9.0E-22
sp|B0V9W1|PSD_ACIBY Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AYE) GN=psd PE=3 SV=1 1250 1463 9.0E-22
sp|B7I242|PSD_ACIB5 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB0057) GN=psd PE=3 SV=1 1250 1463 9.0E-22
sp|B7GUX2|PSD_ACIB3 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB307-0294) GN=psd PE=3 SV=1 1250 1463 9.0E-22
sp|Q221E5|PSD_RHOFT Phosphatidylserine decarboxylase proenzyme OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=psd PE=3 SV=2 1229 1441 9.0E-22
sp|B2I1N9|PSD_ACIBC Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ACICU) GN=psd PE=3 SV=1 1250 1463 1.0E-21
sp|C1DLP2|PSD_AZOVD Phosphatidylserine decarboxylase proenzyme OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=psd PE=3 SV=1 1229 1463 1.0E-21
sp|P39822|PSD_BACSU Phosphatidylserine decarboxylase proenzyme OS=Bacillus subtilis (strain 168) GN=psd PE=1 SV=1 1188 1437 1.0E-21
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 1229 1444 2.0E-21
sp|C5CU16|PSD_VARPS Phosphatidylserine decarboxylase proenzyme OS=Variovorax paradoxus (strain S110) GN=psd PE=3 SV=1 1232 1443 2.0E-21
sp|B0TZM7|PSD_FRAP2 Phosphatidylserine decarboxylase proenzyme OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=psd PE=3 SV=1 1247 1432 2.0E-21
sp|Q1I433|PSD_PSEE4 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas entomophila (strain L48) GN=psd PE=3 SV=1 1232 1444 3.0E-21
sp|Q9CJU2|PSD_PASMU Phosphatidylserine decarboxylase proenzyme OS=Pasteurella multocida (strain Pm70) GN=psd PE=3 SV=1 1229 1447 3.0E-21
sp|Q4KJ87|PSD_PSEF5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=psd PE=3 SV=1 1232 1465 6.0E-21
sp|Q8D2C6|PSD_WIGBR Phosphatidylserine decarboxylase proenzyme OS=Wigglesworthia glossinidia brevipalpis GN=psd PE=3 SV=1 1232 1444 7.0E-21
sp|Q0I4T3|PSD_HAES1 Phosphatidylserine decarboxylase proenzyme OS=Haemophilus somnus (strain 129Pt) GN=psd PE=3 SV=1 1229 1438 8.0E-21
sp|B9MAC0|PSD_ACIET Phosphatidylserine decarboxylase proenzyme OS=Acidovorax ebreus (strain TPSY) GN=psd PE=3 SV=1 1229 1440 9.0E-21
sp|Q12J86|PSD_SHEDO Phosphatidylserine decarboxylase proenzyme OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=psd PE=3 SV=1 1232 1438 1.0E-20
sp|Q65RD9|PSD_MANSM Phosphatidylserine decarboxylase proenzyme OS=Mannheimia succiniciproducens (strain MBEL55E) GN=psd PE=3 SV=2 1229 1459 2.0E-20
sp|Q493W4|PSD_BLOPB Phosphatidylserine decarboxylase proenzyme OS=Blochmannia pennsylvanicus (strain BPEN) GN=psd PE=3 SV=1 1232 1465 2.0E-20
sp|Q3KJ03|PSD_PSEPF Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf0-1) GN=psd PE=3 SV=1 1232 1444 3.0E-20
sp|C3KDM6|PSD_PSEFS Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain SBW25) GN=psd PE=3 SV=1 1232 1463 3.0E-20
sp|Q3BRK2|PSD_XANC5 Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=psd PE=3 SV=1 1245 1468 3.0E-20
sp|Q7VQP8|PSD_BLOFL Phosphatidylserine decarboxylase proenzyme OS=Blochmannia floridanus GN=psd PE=3 SV=1 1232 1465 4.0E-20
sp|Q8PJ17|PSD_XANAC Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas axonopodis pv. citri (strain 306) GN=psd PE=3 SV=1 1245 1468 4.0E-20
sp|Q3J754|PSD_NITOC Phosphatidylserine decarboxylase proenzyme OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=psd PE=3 SV=1 1248 1463 5.0E-20
sp|B0UWL4|PSD_HISS2 Phosphatidylserine decarboxylase proenzyme OS=Histophilus somni (strain 2336) GN=psd PE=3 SV=1 1229 1438 6.0E-20
sp|Q7MYS6|PSD_PHOLL Phosphatidylserine decarboxylase proenzyme OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=psd PE=3 SV=1 1229 1433 6.0E-20
sp|Q1GZE8|PSD_METFK Phosphatidylserine decarboxylase proenzyme OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=psd PE=3 SV=1 1229 1437 8.0E-20
sp|B0BR01|PSD_ACTPJ Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=psd PE=3 SV=1 1229 1444 9.0E-20
sp|B3H2F9|PSD_ACTP7 Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=psd PE=3 SV=1 1229 1444 9.0E-20
sp|A3N255|PSD_ACTP2 Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=psd PE=3 SV=1 1229 1444 9.0E-20
sp|A4IZN0|PSD_FRATW Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=psd PE=3 SV=1 1247 1431 1.0E-19
sp|Q5NHR3|PSD_FRATT Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=psd PE=3 SV=2 1247 1431 1.0E-19
sp|Q0BN99|PSD_FRATO Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=psd PE=3 SV=1 1247 1431 1.0E-19
sp|B2SFB2|PSD_FRATM Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=psd PE=3 SV=1 1247 1431 1.0E-19
sp|Q2A4Y0|PSD_FRATH Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain LVS) GN=psd PE=3 SV=1 1247 1431 1.0E-19
sp|A7NAF0|PSD_FRATF Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=psd PE=3 SV=1 1247 1431 1.0E-19
sp|Q14J65|PSD_FRAT1 Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=psd PE=3 SV=1 1247 1431 1.0E-19
sp|A0Q562|PSD_FRATN Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. novicida (strain U112) GN=psd PE=3 SV=1 1247 1431 1.0E-19
sp|Q1QUI2|PSD_CHRSD Phosphatidylserine decarboxylase proenzyme OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=psd PE=3 SV=1 1229 1454 1.0E-19
sp|A1KBF9|PSD_AZOSB Phosphatidylserine decarboxylase proenzyme OS=Azoarcus sp. (strain BH72) GN=psd PE=3 SV=1 1198 1463 2.0E-19
sp|Q47VZ2|PSD_COLP3 Phosphatidylserine decarboxylase proenzyme OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=psd PE=3 SV=1 1229 1406 4.0E-19
sp|Q8P7Q6|PSD_XANCP Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=psd PE=3 SV=1 1250 1432 8.0E-19
sp|Q4UWE4|PSD_XANC8 Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain 8004) GN=psd PE=3 SV=1 1250 1432 8.0E-19
sp|B0RR72|PSD_XANCB Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain B100) GN=psd PE=3 SV=1 1250 1432 8.0E-19
sp|Q87DS7|PSD_XYLFT Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=psd PE=3 SV=1 1238 1432 9.0E-19
sp|B2I9I2|PSD_XYLF2 Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M23) GN=psd PE=3 SV=1 1238 1432 9.0E-19
sp|Q9HUK8|PSD_PSEAE Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=psd PE=3 SV=1 1229 1432 9.0E-19
sp|A1WIF0|PSD_VEREI Phosphatidylserine decarboxylase proenzyme OS=Verminephrobacter eiseniae (strain EF01-2) GN=psd PE=3 SV=1 1229 1441 1.0E-18
sp|C4K3T9|PSD_HAMD5 Phosphatidylserine decarboxylase proenzyme OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=psd PE=3 SV=1 1208 1433 1.0E-18
sp|Q5GXQ3|PSD_XANOR Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=psd PE=3 SV=1 1245 1468 2.0E-18
sp|Q2P0T0|PSD_XANOM Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=psd PE=3 SV=1 1245 1468 2.0E-18
sp|B7V346|PSD_PSEA8 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain LESB58) GN=psd PE=3 SV=1 1229 1432 2.0E-18
sp|Q02F61|PSD_PSEAB Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=psd PE=3 SV=1 1229 1432 2.0E-18
sp|A9C3H8|PSD_DELAS Phosphatidylserine decarboxylase proenzyme OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=psd PE=3 SV=1 1229 1459 3.0E-18
sp|Q15Q53|PSD_PSEA6 Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=psd PE=3 SV=1 1229 1440 3.0E-18
sp|Q0VMD7|PSD_ALCBS Phosphatidylserine decarboxylase proenzyme OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=psd PE=3 SV=1 1229 1444 5.0E-18
sp|B8JBF7|PSD_ANAD2 Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=psd PE=3 SV=1 1223 1466 7.0E-18
sp|Q5R8I8|PISD_PONAB Phosphatidylserine decarboxylase proenzyme OS=Pongo abelii GN=PISD PE=2 SV=1 1192 1434 1.0E-17
sp|Q9UG56|PISD_HUMAN Phosphatidylserine decarboxylase proenzyme OS=Homo sapiens GN=PISD PE=2 SV=4 1192 1434 1.0E-17
sp|B0U6J7|PSD_XYLFM Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M12) GN=psd PE=3 SV=1 1238 1432 1.0E-17
sp|B4UEL4|PSD_ANASK Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter sp. (strain K) GN=psd PE=3 SV=1 1231 1466 1.0E-17
sp|P53037|PSD2_YEAST Phosphatidylserine decarboxylase proenzyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD2 PE=1 SV=1 698 919 2.0E-17
sp|A6VD70|PSD_PSEA7 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain PA7) GN=psd PE=3 SV=1 1229 1432 2.0E-17
sp|Q7VNA7|PSD_HAEDU Phosphatidylserine decarboxylase proenzyme OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=psd PE=3 SV=1 1250 1459 2.0E-17
sp|Q9PDL4|PSD_XYLFA Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain 9a5c) GN=psd PE=3 SV=1 1238 1432 6.0E-17
sp|P27465|PISD_CRIGR Phosphatidylserine decarboxylase proenzyme OS=Cricetulus griseus GN=PISD PE=1 SV=2 1175 1434 2.0E-16
sp|Q10949|PISD_CAEEL Phosphatidylserine decarboxylase proenzyme OS=Caenorhabditis elegans GN=psd-1 PE=3 SV=2 1227 1434 2.0E-16
sp|Q9PP76|PSD_CAMJE Phosphatidylserine decarboxylase proenzyme OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=psd PE=3 SV=1 1232 1467 4.0E-16
sp|Q58DH2|PISD_BOVIN Phosphatidylserine decarboxylase proenzyme OS=Bos taurus GN=PISD PE=2 SV=1 1192 1434 4.0E-16
sp|Q8BSF4|PISD_MOUSE Phosphatidylserine decarboxylase proenzyme OS=Mus musculus GN=Pisd PE=2 SV=1 1232 1434 5.0E-16
sp|A1WV88|PSD_HALHL Phosphatidylserine decarboxylase proenzyme OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=psd PE=3 SV=1 1238 1463 4.0E-15
sp|Q10T43|PSD1_ORYSJ Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Oryza sativa subsp. japonica GN=PSD1 PE=2 SV=1 1235 1465 3.0E-14
sp|Q1CRQ1|PSD_HELPH Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain HPAG1) GN=psd PE=3 SV=1 1232 1437 8.0E-12
sp|O25911|PSD_HELPY Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=psd PE=3 SV=1 1232 1437 1.0E-11
sp|Q9ZJN0|PSD_HELPJ Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=psd PE=3 SV=1 1232 1437 5.0E-11
sp|B6JNM7|PSD_HELP2 Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain P12) GN=psd PE=3 SV=1 1232 1437 1.0E-10
sp|B2UVC1|PSD_HELPS Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain Shi470) GN=psd PE=3 SV=1 1232 1437 3.0E-10
sp|Q9LVH4|CAR4_ARATH Protein C2-DOMAIN ABA-RELATED 4 OS=Arabidopsis thaliana GN=CAR4 PE=1 SV=1 710 810 4.0E-09
sp|O14333|PSD1_SCHPO Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd1 PE=3 SV=4 1327 1463 6.0E-09
sp|Q9FHP6|CAR1_ARATH Protein C2-DOMAIN ABA-RELATED 1 OS=Arabidopsis thaliana GN=CAR1 PE=1 SV=1 711 810 1.0E-08
sp|Q9UTB5|PSD2_SCHPO Phosphatidylserine decarboxylase proenzyme 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd2 PE=3 SV=1 1327 1437 2.0E-08
sp|Q9ZVF1|CAR10_ARATH Protein C2-DOMAIN ABA-RELATED 10 OS=Arabidopsis thaliana GN=CAR10 PE=2 SV=1 740 810 3.0E-08
sp|Q9SSL1|CAR7_ARATH Protein C2-DOMAIN ABA-RELATED 7 OS=Arabidopsis thaliana GN=CAR7 PE=1 SV=1 711 810 4.0E-08
sp|Q9FVJ3|AGD12_ARATH ADP-ribosylation factor GTPase-activating protein AGD12 OS=Arabidopsis thaliana GN=AGD12 PE=1 SV=1 705 823 1.0E-07
sp|Q54E35|GACEE_DICDI Rho GTPase-activating protein gacEE OS=Dictyostelium discoideum GN=gacEE PE=3 SV=2 388 520 4.0E-07
sp|Q9S7J9|CAR9_ARATH Protein C2-DOMAIN ABA-RELATED 9 OS=Arabidopsis thaliana GN=CAR9 PE=2 SV=1 713 810 4.0E-07
sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 383 471 6.0E-07
sp|Q8LFN9|AGD13_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana GN=AGD13 PE=2 SV=1 708 823 6.0E-07
sp|Q9S764|CAR6_ARATH Protein C2-DOMAIN ABA-RELATED 6 OS=Arabidopsis thaliana GN=CAR6 PE=1 SV=1 711 810 8.0E-07
sp|Q9LP65|CAR5_ARATH Protein C2-DOMAIN ABA-RELATED 5 OS=Arabidopsis thaliana GN=CAR5 PE=2 SV=1 710 806 1.0E-06
sp|B3DLH6|MYOF_XENTR Myoferlin OS=Xenopus tropicalis GN=myof PE=2 SV=1 666 808 1.0E-06
sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 383 471 1.0E-06
sp|P47709|RP3A_RAT Rabphilin-3A OS=Rattus norvegicus GN=Rph3a PE=1 SV=1 384 475 2.0E-06
sp|P47708|RP3A_MOUSE Rabphilin-3A OS=Mus musculus GN=Rph3a PE=1 SV=2 384 475 2.0E-06
sp|Q06846|RP3A_BOVIN Rabphilin-3A OS=Bos taurus GN=RPH3A PE=1 SV=1 384 475 2.0E-06
sp|Q9Y2J0|RP3A_HUMAN Rabphilin-3A OS=Homo sapiens GN=RPH3A PE=1 SV=1 384 475 2.0E-06
sp|Q9C6B7|CAR3_ARATH Protein C2-DOMAIN ABA-RELATED 3 OS=Arabidopsis thaliana GN=CAR3 PE=3 SV=1 710 810 3.0E-06
sp|Q69ZN7|MYOF_MOUSE Myoferlin OS=Mus musculus GN=Myof PE=1 SV=2 666 799 3.0E-06
sp|O49303|CAR8_ARATH Protein C2-DOMAIN ABA-RELATED 8 OS=Arabidopsis thaliana GN=CAR8 PE=2 SV=1 740 810 5.0E-06
sp|Q9C8Y2|CAR2_ARATH Protein C2-DOMAIN ABA-RELATED 2 OS=Arabidopsis thaliana GN=CAR2 PE=3 SV=1 740 811 5.0E-06
sp|Q99N80|SYTL1_MOUSE Synaptotagmin-like protein 1 OS=Mus musculus GN=Sytl1 PE=1 SV=2 384 519 6.0E-06
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 714 855 7.0E-06
sp|B2JDN8|PSD_BURP8 Phosphatidylserine decarboxylase proenzyme OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=psd PE=3 SV=1 1255 1432 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004609 phosphatidylserine decarboxylase activity Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0016831 carboxy-lyase activity No
GO:0009058 biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0090407 organophosphate biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0016829 lyase activity No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0009987 cellular process No
GO:0008610 lipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006629 lipid metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|088280
MAGFFTHLLAFTTFAVCVANAQITGTTPATPLVSKTSFTYPSGVPFKVDTDTQLIRGPQSGYNLCNSTTEGQESL
CQTSFINSIEDFCLWSAIEPGSLVGDVEGEMVAWCTKPGRGTRLIPEGALHGVQFMKTPDYIQVVGFVNQEMINL
AVGDFGGEMDPHGADLRGNPLGGIVFSESFNGQWTQVIEWHNFMGSNSFCFKACDPSKSDDARYCEHRFDRIGCA
FNAPNNAQNGTFESCEGDNQDFPGVYTENGAVMTYAQPPESLGPITQIPYVARVPPSSNCVQYTSSAIYTALPRV
GPETSTSASTTSGTGSGSTRPTAGSATQTADGASATNAGSRVVVAGCEIVMAALIFRRALKSAARLPVKPGKSSG
PTESPFVVLRVQIVSCADLLAKDRNSSSDPFVVLSVLNTRHHTPVARKTLNPTYKDAIFDFPLYLSTADKLGALE
LVVWDKDVLGKDYLGEAALPLEHWFVDRPHGFDDPGSFPFTIPLISTRSSTRSTGSICLRLGFVDASSQLSFADA
FDELNKRSRPSLVSAPPTEGVGTIRSHQSDPAFQDDGGLSSDEDDDDDDDFVDAPEPPSPLATDQSTIEPKLQPE
TIDSSLTTPVNSDTPTKTSAKSGLFIPRMKFPRSLSGLTSPRSTSKDGSSTPTSSSPPSSPEVLDAKFRKGITRK
PTADSTDTATATVDLSVPPVKKKKRGTDFKLAGGNDILGIVMLEIQGAEDLPRLRNMTRTGWDMDPFVVISFGKK
VFRTRVIRHSRNPSWDEKLLFHVRRYEASFNVQLAILDWDKLSANDHIGDVSFNVKELLECAPQPGENGLYADEA
EDGDHPMKEFKMPLVVAKEVPGESKHTPMISFRAKYQPYDALRQRFWRQYMKQYDADGTGALSHVEITTMLDSLG
STLSSSSISTFFTRYGKRAHEDELSFNETILCLEEELNRPEDQKRRLDEDNGDSSVDATPVLQFADGTGKVLQLD
QLDFSGPANLHGASEAPGETRTEPMQVPLHQAASSPTPPEFSSSDDAEEDLSVGSPSTLSPAIGSPTTPQAKKGG
AFKGVRVRVGRRKRRSQISSSNVSASEDSSNKEDTVERVINIKNCPLCHRPRMNSKAEMDIMTHIAVCASQDWNR
VDHIMVGNFVTASQAQRKWYTKVISKLSSGDYKLGANSANIIVQNRMTGQLEEEKMQVYVRLGIRLLYKGVKGRM
EGNRARKLLKSLSIKQGIKYDSPESAEDIPAFIEFHKLNMDEILDPLESFKNFNQFFYRKLKPSARPIEALDDPY
RLVSAADCRLMAFETVHEATKIWVKGREFSVPRLLGDVYKDEVDKYVGGALAIFRLAPQDYHRFHSPVDGVIGKM
TYISGEYYTVNPQAIRTALDVYGDNVRKIVPIDSPQFGRVMAVCVGAMMVGSILTTVEEGQEVKRGQEFGYFAFG
GSTIVLLFEKGAVTWDEDLLVNGRASLETLVRVGMGIGVGARRPTS*
Coding >AgabiH97|088280
ATGGCCGGATTTTTCACCCACTTGTTAGCGTTTACGACTTTTGCCGTGTGTGTGGCCAATGCACAAATTACGGGC
ACGACACCCGCCACACCGTTGGTGTCCAAAACGTCGTTCACATACCCAAGCGGAGTGCCGTTCAAAGTGGATACG
GATACGCAACTGATCCGTGGACCCCAGTCAGGATATAATTTGTGTAATTCGACAACAGAGGGGCAAGAGTCGTTG
TGTCAGACGTCGTTCATCAACAGTATAGAAGACTTTTGTTTATGGTCGGCTATAGAACCAGGAAGTCTTGTTGGG
GACGTCGAAGGCGAGATGGTGGCGTGGTGTACGAAACCAGGACGAGGGACGCGACTGATACCAGAGGGCGCTCTT
CACGGAGTGCAATTTATGAAAACACCCGACTACATCCAAGTGGTCGGGTTTGTGAATCAAGAAATGATCAATTTG
GCGGTAGGCGATTTTGGGGGGGAGATGGACCCACATGGAGCGGACTTGAGGGGGAATCCGTTGGGTGGGATTGTG
TTCTCTGAGTCGTTCAATGGGCAATGGACACAGGTGATTGAATGGCACAACTTTATGGGCTCGAACTCGTTTTGT
TTCAAGGCATGTGACCCTAGCAAGAGTGACGATGCGCGGTACTGTGAACACCGATTCGACCGCATTGGCTGTGCC
TTCAACGCGCCCAACAATGCCCAGAACGGGACATTCGAGTCTTGTGAAGGCGACAACCAAGATTTCCCGGGGGTG
TACACAGAGAACGGGGCTGTGATGACGTACGCGCAGCCACCAGAGTCACTGGGACCGATTACACAGATCCCGTAC
GTGGCGCGTGTGCCGCCGTCGTCCAACTGCGTGCAGTACACGAGTTCTGCCATCTACACTGCACTGCCTCGAGTG
GGTCCTGAGACGTCGACTTCGGCGTCGACCACATCGGGCACGGGAAGTGGGAGCACGCGCCCGACGGCCGGCAGT
GCGACGCAGACGGCTGATGGGGCCTCGGCAACGAACGCGGGGTCGCGGGTTGTAGTTGCGGGGTGTGAAATCGTG
ATGGCCGCGTTGATATTTCGGCGTGCGCTCAAGTCTGCCGCGCGTCTGCCTGTAAAACCTGGCAAGAGCAGTGGA
CCGACCGAGTCACCGTTTGTGGTACTGCGAGTGCAGATTGTGAGCTGCGCTGACCTGCTGGCCAAGGACCGCAAC
TCGTCGAGTGACCCCTTTGTCGTTCTCTCCGTCCTCAACACCCGCCACCACACCCCCGTCGCTCGCAAAACCCTC
AATCCTACCTACAAAGACGCCATCTTTGATTTTCCTCTCTACCTCTCCACCGCAGACAAACTCGGCGCTCTCGAG
CTCGTTGTCTGGGATAAGGACGTCCTCGGCAAGGATTACCTCGGGGAGGCTGCATTGCCACTCGAACACTGGTTT
GTCGACAGACCGCATGGGTTCGATGACCCAGGTAGCTTCCCTTTCACGATCCCCCTCATTTCAACCCGATCCAGC
ACCCGATCCACTGGCTCCATCTGCCTCAGGCTCGGCTTTGTTGATGCTTCCTCTCAACTCTCCTTTGCCGATGCC
TTTGACGAACTCAACAAACGCTCCAGGCCCTCGCTTGTATCTGCCCCCCCAACAGAAGGCGTCGGCACCATTCGC
TCTCATCAATCCGACCCCGCTTTCCAAGATGACGGCGGTCTATCGTCTGACGAAGACGACGACGACGACGACGAT
TTCGTCGACGCCCCCGAACCCCCGAGCCCGCTCGCCACCGATCAGTCCACGATCGAACCCAAACTTCAGCCTGAA
ACCATCGATTCTTCTCTTACTACCCCGGTCAACTCTGATACCCCCACCAAGACTTCTGCAAAATCTGGATTATTT
ATTCCCCGCATGAAGTTTCCCCGTTCTCTTTCTGGACTCACCTCTCCTCGCTCCACCTCTAAAGATGGCTCCTCT
ACACCCACTTCATCAAGCCCTCCATCTTCACCCGAGGTGCTCGATGCCAAATTCAGAAAGGGCATCACCCGTAAA
CCCACTGCGGATAGCACAGACACTGCCACAGCCACCGTTGATCTCTCTGTACCTCCCGTGAAGAAAAAGAAGAGG
GGGACAGACTTTAAACTGGCGGGCGGAAACGACATTTTGGGTATAGTTATGCTCGAGATCCAAGGCGCGGAAGAC
TTGCCTAGACTACGTAACATGACACGTACCGGTTGGGATATGGATCCTTTTGTCGTTATCTCCTTTGGGAAAAAA
GTCTTTCGCACTCGCGTCATTCGTCACTCCCGTAACCCCTCCTGGGACGAGAAACTCTTGTTTCACGTCCGTCGG
TACGAAGCCTCCTTCAACGTCCAATTGGCCATTTTGGACTGGGATAAACTCTCCGCCAACGATCACATAGGTGAT
GTCAGTTTCAACGTCAAGGAATTGTTGGAATGTGCGCCACAGCCCGGAGAGAATGGGTTGTATGCGGACGAGGCC
GAGGACGGTGATCACCCCATGAAAGAGTTCAAGATGCCTTTGGTCGTTGCCAAGGAAGTTCCGGGAGAGTCTAAA
CATACTCCCATGATTTCGTTCCGTGCGAAATATCAACCTTACGATGCCCTTCGCCAGCGCTTCTGGCGTCAATAC
ATGAAACAGTACGATGCCGATGGTACAGGCGCACTCTCTCACGTCGAAATAACGACCATGCTCGACTCTCTTGGA
TCTACCCTGTCCTCCTCATCTATATCCACCTTCTTTACGCGTTACGGTAAAAGGGCACACGAAGATGAACTGTCT
TTCAATGAAACCATCCTTTGTTTAGAAGAAGAATTGAATCGACCTGAAGATCAGAAACGACGATTGGACGAGGAT
AACGGTGACTCGAGTGTAGATGCGACGCCGGTATTGCAATTTGCAGATGGGACTGGAAAAGTGTTGCAGCTCGAT
CAACTTGATTTCTCTGGCCCTGCAAATCTTCATGGCGCTTCGGAAGCTCCTGGTGAGACCAGAACGGAGCCCATG
CAAGTGCCTCTTCATCAAGCTGCTTCCTCGCCTACGCCACCCGAATTCAGTTCTTCGGATGATGCAGAGGAAGAC
CTGTCTGTAGGATCGCCTTCCACCTTGAGTCCTGCTATCGGTAGTCCAACCACTCCTCAAGCAAAGAAAGGTGGA
GCGTTCAAGGGAGTCCGTGTTCGTGTAGGCCGCCGAAAACGCAGAAGCCAGATATCCTCTTCAAACGTCTCTGCC
TCGGAAGACAGCAGTAACAAAGAAGATACGGTCGAACGTGTTATCAATATCAAGAATTGTCCACTCTGTCATCGA
CCTCGCATGAATTCGAAAGCAGAGATGGATATTATGACTCATATTGCTGTTTGTGCTTCTCAAGATTGGAATAGG
GTGGATCATATTATGGTTGGGAATTTTGTGACGGCGAGTCAGGCTCAGAGGAAGTGGTATACGAAAGTGATTTCA
AAGTTGAGTAGTGGAGATTACAAGTTGGGTGCTAACTCGGCGAATATTATTGTTCAAAATCGGATGACGGGGCAG
TTGGAGGAAGAGAAGATGCAAGTGTATGTCAGGTTGGGAATTCGGTTGTTGTACAAGGGTGTGAAAGGGCGTATG
GAAGGTAATCGAGCTCGTAAACTTCTCAAGTCTCTCTCCATTAAACAAGGTATCAAGTATGATTCTCCGGAATCT
GCTGAAGACATACCTGCATTTATCGAATTTCACAAATTGAATATGGATGAAATCCTTGATCCCCTTGAGTCATTC
AAAAACTTTAATCAATTCTTTTATCGCAAGCTCAAACCTTCTGCTCGCCCCATCGAAGCCCTCGATGATCCTTAC
CGTCTCGTCAGTGCTGCCGACTGTCGTCTTATGGCTTTCGAAACCGTGCATGAGGCTACGAAGATCTGGGTCAAA
GGGCGAGAGTTTTCGGTTCCGAGACTTTTGGGGGATGTGTATAAAGATGAGGTGGATAAGTATGTTGGGGGGGCG
TTGGCGATATTTAGGTTGGCTCCACAGGATTATCATCGATTTCATTCACCTGTGGATGGTGTTATTGGAAAGATG
ACGTATATTTCTGGAGAGTATTATACTGTCAACCCACAAGCGATTCGGACGGCGTTGGATGTTTATGGAGATAAT
GTACGCAAGATTGTGCCTATTGATAGTCCGCAGTTTGGACGCGTGATGGCTGTTTGTGTGGGTGCGATGATGGTG
GGGAGTATTTTGACGACTGTGGAGGAAGGACAGGAAGTGAAACGTGGTCAGGAATTTGGATATTTTGCATTTGGT
GGGTCGACGATTGTGTTGTTGTTTGAGAAGGGTGCTGTGACTTGGGATGAGGATCTGTTGGTTAATGGGAGAGCG
TCTTTGGAGACTTTGGTAAGAGTTGGGATGGGGATTGGAGTTGGTGCTCGACGTCCTACCAGTTAA
Transcript >AgabiH97|088280
ATGGCCGGATTTTTCACCCACTTGTTAGCGTTTACGACTTTTGCCGTGTGTGTGGCCAATGCACAAATTACGGGC
ACGACACCCGCCACACCGTTGGTGTCCAAAACGTCGTTCACATACCCAAGCGGAGTGCCGTTCAAAGTGGATACG
GATACGCAACTGATCCGTGGACCCCAGTCAGGATATAATTTGTGTAATTCGACAACAGAGGGGCAAGAGTCGTTG
TGTCAGACGTCGTTCATCAACAGTATAGAAGACTTTTGTTTATGGTCGGCTATAGAACCAGGAAGTCTTGTTGGG
GACGTCGAAGGCGAGATGGTGGCGTGGTGTACGAAACCAGGACGAGGGACGCGACTGATACCAGAGGGCGCTCTT
CACGGAGTGCAATTTATGAAAACACCCGACTACATCCAAGTGGTCGGGTTTGTGAATCAAGAAATGATCAATTTG
GCGGTAGGCGATTTTGGGGGGGAGATGGACCCACATGGAGCGGACTTGAGGGGGAATCCGTTGGGTGGGATTGTG
TTCTCTGAGTCGTTCAATGGGCAATGGACACAGGTGATTGAATGGCACAACTTTATGGGCTCGAACTCGTTTTGT
TTCAAGGCATGTGACCCTAGCAAGAGTGACGATGCGCGGTACTGTGAACACCGATTCGACCGCATTGGCTGTGCC
TTCAACGCGCCCAACAATGCCCAGAACGGGACATTCGAGTCTTGTGAAGGCGACAACCAAGATTTCCCGGGGGTG
TACACAGAGAACGGGGCTGTGATGACGTACGCGCAGCCACCAGAGTCACTGGGACCGATTACACAGATCCCGTAC
GTGGCGCGTGTGCCGCCGTCGTCCAACTGCGTGCAGTACACGAGTTCTGCCATCTACACTGCACTGCCTCGAGTG
GGTCCTGAGACGTCGACTTCGGCGTCGACCACATCGGGCACGGGAAGTGGGAGCACGCGCCCGACGGCCGGCAGT
GCGACGCAGACGGCTGATGGGGCCTCGGCAACGAACGCGGGGTCGCGGGTTGTAGTTGCGGGGTGTGAAATCGTG
ATGGCCGCGTTGATATTTCGGCGTGCGCTCAAGTCTGCCGCGCGTCTGCCTGTAAAACCTGGCAAGAGCAGTGGA
CCGACCGAGTCACCGTTTGTGGTACTGCGAGTGCAGATTGTGAGCTGCGCTGACCTGCTGGCCAAGGACCGCAAC
TCGTCGAGTGACCCCTTTGTCGTTCTCTCCGTCCTCAACACCCGCCACCACACCCCCGTCGCTCGCAAAACCCTC
AATCCTACCTACAAAGACGCCATCTTTGATTTTCCTCTCTACCTCTCCACCGCAGACAAACTCGGCGCTCTCGAG
CTCGTTGTCTGGGATAAGGACGTCCTCGGCAAGGATTACCTCGGGGAGGCTGCATTGCCACTCGAACACTGGTTT
GTCGACAGACCGCATGGGTTCGATGACCCAGGTAGCTTCCCTTTCACGATCCCCCTCATTTCAACCCGATCCAGC
ACCCGATCCACTGGCTCCATCTGCCTCAGGCTCGGCTTTGTTGATGCTTCCTCTCAACTCTCCTTTGCCGATGCC
TTTGACGAACTCAACAAACGCTCCAGGCCCTCGCTTGTATCTGCCCCCCCAACAGAAGGCGTCGGCACCATTCGC
TCTCATCAATCCGACCCCGCTTTCCAAGATGACGGCGGTCTATCGTCTGACGAAGACGACGACGACGACGACGAT
TTCGTCGACGCCCCCGAACCCCCGAGCCCGCTCGCCACCGATCAGTCCACGATCGAACCCAAACTTCAGCCTGAA
ACCATCGATTCTTCTCTTACTACCCCGGTCAACTCTGATACCCCCACCAAGACTTCTGCAAAATCTGGATTATTT
ATTCCCCGCATGAAGTTTCCCCGTTCTCTTTCTGGACTCACCTCTCCTCGCTCCACCTCTAAAGATGGCTCCTCT
ACACCCACTTCATCAAGCCCTCCATCTTCACCCGAGGTGCTCGATGCCAAATTCAGAAAGGGCATCACCCGTAAA
CCCACTGCGGATAGCACAGACACTGCCACAGCCACCGTTGATCTCTCTGTACCTCCCGTGAAGAAAAAGAAGAGG
GGGACAGACTTTAAACTGGCGGGCGGAAACGACATTTTGGGTATAGTTATGCTCGAGATCCAAGGCGCGGAAGAC
TTGCCTAGACTACGTAACATGACACGTACCGGTTGGGATATGGATCCTTTTGTCGTTATCTCCTTTGGGAAAAAA
GTCTTTCGCACTCGCGTCATTCGTCACTCCCGTAACCCCTCCTGGGACGAGAAACTCTTGTTTCACGTCCGTCGG
TACGAAGCCTCCTTCAACGTCCAATTGGCCATTTTGGACTGGGATAAACTCTCCGCCAACGATCACATAGGTGAT
GTCAGTTTCAACGTCAAGGAATTGTTGGAATGTGCGCCACAGCCCGGAGAGAATGGGTTGTATGCGGACGAGGCC
GAGGACGGTGATCACCCCATGAAAGAGTTCAAGATGCCTTTGGTCGTTGCCAAGGAAGTTCCGGGAGAGTCTAAA
CATACTCCCATGATTTCGTTCCGTGCGAAATATCAACCTTACGATGCCCTTCGCCAGCGCTTCTGGCGTCAATAC
ATGAAACAGTACGATGCCGATGGTACAGGCGCACTCTCTCACGTCGAAATAACGACCATGCTCGACTCTCTTGGA
TCTACCCTGTCCTCCTCATCTATATCCACCTTCTTTACGCGTTACGGTAAAAGGGCACACGAAGATGAACTGTCT
TTCAATGAAACCATCCTTTGTTTAGAAGAAGAATTGAATCGACCTGAAGATCAGAAACGACGATTGGACGAGGAT
AACGGTGACTCGAGTGTAGATGCGACGCCGGTATTGCAATTTGCAGATGGGACTGGAAAAGTGTTGCAGCTCGAT
CAACTTGATTTCTCTGGCCCTGCAAATCTTCATGGCGCTTCGGAAGCTCCTGGTGAGACCAGAACGGAGCCCATG
CAAGTGCCTCTTCATCAAGCTGCTTCCTCGCCTACGCCACCCGAATTCAGTTCTTCGGATGATGCAGAGGAAGAC
CTGTCTGTAGGATCGCCTTCCACCTTGAGTCCTGCTATCGGTAGTCCAACCACTCCTCAAGCAAAGAAAGGTGGA
GCGTTCAAGGGAGTCCGTGTTCGTGTAGGCCGCCGAAAACGCAGAAGCCAGATATCCTCTTCAAACGTCTCTGCC
TCGGAAGACAGCAGTAACAAAGAAGATACGGTCGAACGTGTTATCAATATCAAGAATTGTCCACTCTGTCATCGA
CCTCGCATGAATTCGAAAGCAGAGATGGATATTATGACTCATATTGCTGTTTGTGCTTCTCAAGATTGGAATAGG
GTGGATCATATTATGGTTGGGAATTTTGTGACGGCGAGTCAGGCTCAGAGGAAGTGGTATACGAAAGTGATTTCA
AAGTTGAGTAGTGGAGATTACAAGTTGGGTGCTAACTCGGCGAATATTATTGTTCAAAATCGGATGACGGGGCAG
TTGGAGGAAGAGAAGATGCAAGTGTATGTCAGGTTGGGAATTCGGTTGTTGTACAAGGGTGTGAAAGGGCGTATG
GAAGGTAATCGAGCTCGTAAACTTCTCAAGTCTCTCTCCATTAAACAAGGTATCAAGTATGATTCTCCGGAATCT
GCTGAAGACATACCTGCATTTATCGAATTTCACAAATTGAATATGGATGAAATCCTTGATCCCCTTGAGTCATTC
AAAAACTTTAATCAATTCTTTTATCGCAAGCTCAAACCTTCTGCTCGCCCCATCGAAGCCCTCGATGATCCTTAC
CGTCTCGTCAGTGCTGCCGACTGTCGTCTTATGGCTTTCGAAACCGTGCATGAGGCTACGAAGATCTGGGTCAAA
GGGCGAGAGTTTTCGGTTCCGAGACTTTTGGGGGATGTGTATAAAGATGAGGTGGATAAGTATGTTGGGGGGGCG
TTGGCGATATTTAGGTTGGCTCCACAGGATTATCATCGATTTCATTCACCTGTGGATGGTGTTATTGGAAAGATG
ACGTATATTTCTGGAGAGTATTATACTGTCAACCCACAAGCGATTCGGACGGCGTTGGATGTTTATGGAGATAAT
GTACGCAAGATTGTGCCTATTGATAGTCCGCAGTTTGGACGCGTGATGGCTGTTTGTGTGGGTGCGATGATGGTG
GGGAGTATTTTGACGACTGTGGAGGAAGGACAGGAAGTGAAACGTGGTCAGGAATTTGGATATTTTGCATTTGGT
GGGTCGACGATTGTGTTGTTGTTTGAGAAGGGTGCTGTGACTTGGGATGAGGATCTGTTGGTTAATGGGAGAGCG
TCTTTGGAGACTTTGGTAAGAGTTGGGATGGGGATTGGAGTTGGTGCTCGACGTCCTACCAGTTAA
Gene >AgabiH97|088280
ATGGCCGGATTTTTCACCCACTTGTTAGCGTTTACGACTTTTGCCGTGTGTGTGGCCAATGCACAAATTACGGGC
ACGACACCCGCCACACCGTTGGTGTCCAAAACGTCGTTCACATACCCAAGCGGAGTGGTACGTTTGTGTGTCGTC
GTCGCTAGCTTAGACAATTGACGTTCTTTATAGCCGTTCAAAGTGGATACGGATACGCAACTGATCCGTGGACCC
CAGTCAGGATATAATTTGTGTAATTCGACAACAGAGGGGCAAGAGTCGTTGTGTCAGACGTCGTTCATCAACAGT
ATAGAAGACTTTTGTTTATGGTCGGCTATAGAACCAGGAAGTCTTGTTGGGGACGTCGAAGGCGAGATGGTGGCG
TGGTGTACGAAACCAGGACGAGGGACGCGACTGATACCAGAGGGCGCTCTTCACGGAGTGCAATTTATGAAAACA
CCCGACTACATCCAAGTGGTCGGGTTTGTGAATCAAGAAATGATCAATTTGGCGGTAGGCGATTTTGGGGGGGAG
ATGGACCCACATGGAGCGGACTTGAGGGGGAATCCGTTGGGTGGGATTGTGTTCTCTGAGTCGTTCAATGGGCAA
TGGACACAGGTGATTGAATGGCACAAGTAAGCAAATGATTTTGTTCAAGTGGCATGTGTTCTCATCGAGGTTCAG
CTTTATGGGCTCGAACTCGTTTTGTTTCAAGGCATGTGACCCTAGCAAGAGTGACGATGCGCGGTACTGTGAACA
CCGATTCGACCGCATTGGCTGTGCCTTCAACGCGCCCAACAATGCCCAGAACGGGACATTCGAGTCTTGTGAAGG
CGACAACCAAGATTTCCCGGGGGTGTACACAGAGAACGGGGCTGTGATGACGTACGCGCAGCCACCAGAGTCACT
GGGACCGATTACACAGATCCCGTACGTGGCGCGTGTGCCGCCGTCGTCCAACTGCGTGCAGTACACGAGTTCTGC
CATCTACACTGCACTGCCTCGAGTGGGTCCTGAGACGTCGACTTCGGCGTCGACCACATCGGGCACGGGAAGTGG
GAGCACGCGCCCGACGGCCGGCAGTGCGACGCAGACGGCTGATGGGGCCTCGGCAACGAACGCGGGGTCGCGGGT
TGTAGTTGCGGGGTGTGAAATCGTGATGGCCGCGTTGATAGTAATGTGGATAATGTAGCTACGTTGTATCTTTTA
ACTTACCATGTCAACCAAGTTTCGGCGTGCGCTCAAGTCTGCCGCGCGTCTGCCTGTAAAACCTGGCAAGAGCAG
TGGACCGACCGAGTCACCGTTTGTGGTACTGCGAGTGCAGATTGTGAGCTGCGCTGACCTGCTGGCCAAGGACCG
CAACTCGTCGAGTGACCCGTGCGTTCAGTCATTGTGGGCCCAACACCACACTAAACCCTTCTTGCAGCTTTGTCG
TTCTCTCCGTCCTCAACACCCGCCACCACACCCCCGTCGCTCGCAAAACCCTCAATCCTACCTACAAAGACGCCA
TCTTTGATTTTCCTCTCTACCTCTCCACCGCAGACAAACTCGGCGCTCTCGAGCTCGTTGTCTGGGATAAGGACG
TCCTCGGCAAGGATTACCTCGGGGAGGCTGCATTGCCACTCGAACACTGGTTTGTCGACAGACCGCATGGGTTCG
ATGACCCAGGTAGCTTCGTACGTCGGTCTATTCTTCTTCTTCTTCTCTGCTCATCCTCTACAGCCTTTCACGATC
CCCCTCATTTCAACCCGATCCAGCACCCGATCCACTGGCTCCATCTGCCTCAGGCTCGGCTTTGTTGATGCTTCC
TCTCAACTCTCCTTTGCCGATGCCTTTGACGAACTCAACAAACGCTCCAGGCCCTCGCTTGTATCTGCCCCCCCA
GTATGTACATTGTCTTCCGCCCGTTCCCCATCCTCACACCCCTCATTAGACAGAAGGCGTCGGCACCATTCGCTC
TCATCAATCCGACCCCGCTTTCCAAGATGACGGCGGTCTATCGTCTGACGAAGACGACGACGACGACGACGATTT
CGTCGACGCCCCCGAACCCCCGAGCCCGCTCGCCACCGATCAGTCCACGATCGAACCCAAACTTCAGCCTGAAAC
CATCGATTCTTCTCTTACTACCCCGGTCAACTCTGATACCCCCACCAAGACTTCTGCAAAATCTGGATTATTTAT
TCCCCGCATGAAGTTTCCCCGTTCTCTTTCTGGACTCACCTCTCCTCGCTCCACCTCTAAAGATGGCTCCTCTAC
ACCCACTTCATCAAGCCCTCCATCTTCACCCGAGGTGCTCGATGCCAAATTCAGAAAGGGCATCACCCGTAAACC
CACTGCGGATAGCACAGACACTGCCACAGCCACCGTTGATCTCTCTGTACCTCCCGTGAAGAAAAAGAAGAGGGG
GACAGACTTTAAACTGGCGGGCGGAAACGACATTTTGGGTATAGTTATGCTCGAGATCCAAGGCGCGGAAGACTT
GCCTAGACTACGTAACAGTAAGTCGTCTCGTGCTCATCTCACTCTCTTCTCCCTCTTATATGGAAACAGTGACAC
GTACCGGTTGGGATATGGATCCTTTTGTCGTTATCTCCTTTGGGAAAAAAGTCTTTCGCACTCGCGTCATTCGTC
ACTCCCGTAACCCCTCCTGGGACGAGAAACTCTTGTTTCACGTCCGTCGGTACGAAGCCTCCTTCAACGTCCAAT
TGGCCATTTTGGACTGGGATAAACTCTCCGCCAACGATCACATAGGTGATGTCAGTTTCAACGTCAAGGAATTGT
TGGAATGTGCGCCACAGCCCGGAGAGAATGGGTTGTATGCGGACGAGGCCGAGGACGGTGATCACCCCATGAAAG
AGTTCAAGATGCCTTTGGTCGTTGCCAAGGAAGTTCCGGGAGAGTCTAAACATACTCCCATGATTTCGTTCCGGT
GAGCCTTATGCCCCCCTTGAATTCGACAATGATACTCATCATCCTAGTGCGAAATATCAACCTTACGATGCCCTT
CGCCAGCGCTTCTGGCGTCAATACATGAAACAGTACGATGCCGATGGTACAGGCGCACTCTCTCACGTCGAAATA
ACGACCATGCTCGACTCTCTTGGATCTACCCTGTCCTCCTCATCTATATCCACCTTCTTTACGCGTTACGGTAAA
AGGGCACACGAAGATGAACTGTCTTTCAATGAAACCATCCTTTGTTTAGAAGAAGAATTGAATCGACCTGAAGAT
CAGAAACGACGATTGGACGAGGATAACGGTGACTCGAGTGTAGATGCGACGCCGGTATTGCAATTTGCAGATGGG
ACTGGAAAAGTGTTGCAGCTCGATCAACTTGATTTCTCTGGCCCTGCAAATCTTCATGGCGCTTCGGAAGCTCCT
GGTGAGACCAGAACGGAGCCCATGCAAGTGCCTCTTCATCAAGCTGCTTCCTCGCCTACGCCACCCGAATTCAGT
TCTTCGGATGATGCAGAGGAAGACCTGTCTGTAGGATCGCCTTCCACCTTGAGTCCTGCTATCGGTAGTCCAACC
ACTCCTCAAGCAAAGAAAGGTGGAGCGTTCAAGGGAGTCCGTGTTCGTGTAGGCCGCCGAAAACGCAGAAGCCAG
ATATCCTCTTCAAACGTCTCTGCCTCGGAAGACAGCAGTAACAAAGAAGATACGGTCGAACGTGTTATCAATATC
AAGAATTGTCCACTCTGTCATCGACCTCGCATGAATTCGAAAGCAGAGATGGATATTATGACTCATATTGCTGTT
TGTGCTTCTCAAGATTGGAATAGGGTGGATCATATTATGGTTGGGAATTTTGTGACGGCGAGTCAGGCTCAGAGG
AAGTGGTATACGAAAGTGATTTCAAAGTTGAGTAGTGGAGATTACAAGTTGGGTGCTGTGAGTCACTTCCGTTCT
CTGTTCAACTTGATGGTTCGTTTATCTTTCCGGCTAGAACTCGGCGAATATTATTGTTCAAAATCGGATGACGGG
GCAGTTGGAGGAAGAGAAGATGCAAGTGTATGTCAGGTTGGGAATTCGGTTGTTGTACAAGGGTGTGAAAGGGCG
TATGGAAGGTAATCGAGGTGAGAATCTTTGGTTTACCTCGTCGAATTTGTTTCGCTTATTATATGCAGCTCGTAA
ACTTCTCAAGTCTCTCTCCATTAAACAAGGTATCAAGTATGATTCTCCGGAATCTGCTGAAGACATACCTGCATT
TATCGAATTTCACAAATTGAATATGGATGAAATCCTTGATCCCCTTGAGTCATTCAGTACGTGTTTTGTTGTCTC
TACGCCAGCCGTAATGTCTAACGTCATGAAAAAAGAAAACTTTAATCAATTCTTTTATCGCAAGCTCAAACCTTC
TGCTCGCCCCATCGAAGCCCTCGATGATCCTTACCGTCTCGTCAGTGCTGCCGACTGTCGTCTTATGGCTTTCGA
AACCGTGCATGAGGCTACGAAGATCTGGGTCAAAGGGCGAGAGTTTTCGGTTCCGAGACTTTTGGGGGATGTGTA
TAAAGATGAGGTGGATAAGTATGTTGGGGGGGCGTTGGCGATATTTAGGTTGGCTCCACAGGATTATCATCGATT
TCATTCACCTGTGGATGGTGTTATTGGAAAGATGACGTATATTTCTGGAGAGTATTATACTGTCAACGTGAGTTT
TCTTTCAGCTTTTCTTATTTTGTTAATTGCTCATATTTTTTTCTTTTAGCCACAAGCGATTCGGACGGCGTTGGA
TGTTTATGGAGATAATGTACGCAAGATTGTGCCTATTGATAGTCCGCAGTTTGGACGCGTGATGGCTGTTTGTGT
GGGTGCGATGATGGTGGGGAGTATTTTGACGACTGTGGAGGAAGGACAGGAAGTGAAACGTGGTCAGGAATTTGG
ATATTTTGCATTTGGTTTGTTCTTTTTTTTTCTTTCTTTCATTATGTTTTTTTGTTGTTGACAAATATTGAATTG
TAGGTGGGTCGACGATTGTGTTGTTGTTTGAGAAGGGTGCTGTGACTTGGGATGAGGATCTGTTGGTTAATGGGA
GAGCGTCTTTGGAGACTTTGGTAAGAGTTGGGATGGGGATTGGAGTTGGTGCTCGACGTCCTACCAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail