Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|088130
Gene name
Locationscaffold_5:2477425..2478668
Strand+
Gene length (bp)1243
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 267 289 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|088130
MSRKCLWLFGFLLTFARLDSAIGNCNPLHDRLDPISHKFVSSCPDSMYCAPLDGTVALQESTPLMASRLTRIKSK
PPSHQRPSNEPSAETNTGDHSRGICQPRVCRRDEYLFGFSSNDTLPPLCPRHGPGSYFCPDNGGGCQVAKPPGSD
CELARDEQCVPPSHSDGQSVCLNQKCLYANATLFSPCVMENTTYTFQASYSRTSHTVSVVRHNCVSHTLHCDPST
LTCATSKKIGEACEADFQCETVACERGVCYPRADSPNQVPVWQVLITVIAIITAMIVTIFVLIFNHRRRKLKKFR
ELREYYVEQLSLRRTIIAMHTTTIERGKS*
Coding >AgabiH97|088130
ATGTCGCGCAAGTGCTTGTGGCTTTTCGGCTTCCTGTTGACTTTTGCGCGTCTGGATAGTGCCATTGGCAACTGT
AATCCACTTCACGATCGTCTCGACCCAATTTCTCACAAATTTGTCTCCTCATGCCCTGATTCCATGTATTGCGCC
CCTTTGGATGGAACTGTCGCTCTCCAAGAGTCAACACCTTTGATGGCTAGTCGTCTAACTCGTATTAAATCAAAG
CCGCCTTCGCATCAGCGCCCTTCAAACGAACCGTCCGCGGAGACCAACACCGGAGACCACTCAAGAGGAATTTGT
CAACCAAGGGTTTGTAGGCGCGATGAATATCTTTTCGGCTTTTCTTCAAATGACACTTTACCGCCGCTATGCCCA
CGACATGGTCCTGGTTCCTACTTTTGTCCCGATAACGGAGGAGGGTGCCAAGTGGCAAAACCACCCGGGTCAGAT
TGTGAACTCGCACGGGATGAACAGTGTGTTCCACCCTCACATTCAGATGGTCAAAGCGTATGCCTGAATCAAAAA
TGCCTGTATGCAAATGCAACGCTCTTCTCTCCGTGTGTAATGGAAAACACAACGTACACATTCCAAGCCTCGTAC
TCTCGTACTTCGCACACCGTTTCTGTCGTGAGACATAATTGTGTCTCTCATACCCTCCATTGTGATCCTTCGACC
CTTACCTGCGCAACTTCCAAAAAAATTGGTGAAGCTTGCGAGGCAGATTTCCAATGCGAAACGGTTGCATGTGAA
CGAGGGGTATGTTATCCTCGAGCAGACAGTCCGAATCAAGTTCCGGTTTGGCAAGTCTTGATCACTGTTATCGCT
ATCATTACCGCTATGATAGTAACCATCTTCGTTTTGATATTCAATCATCGTCGGCGCAAATTAAAAAAATTCAGA
GAATTGAGGGAGTATTACGTTGAACAACTCAGTCTTCGACGTACAATCATAGCGATGCATACCACCACAATTGAA
AGGGGAAAATCGTAG
Transcript >AgabiH97|088130
ATGTCGCGCAAGTGCTTGTGGCTTTTCGGCTTCCTGTTGACTTTTGCGCGTCTGGATAGTGCCATTGGCAACTGT
AATCCACTTCACGATCGTCTCGACCCAATTTCTCACAAATTTGTCTCCTCATGCCCTGATTCCATGTATTGCGCC
CCTTTGGATGGAACTGTCGCTCTCCAAGAGTCAACACCTTTGATGGCTAGTCGTCTAACTCGTATTAAATCAAAG
CCGCCTTCGCATCAGCGCCCTTCAAACGAACCGTCCGCGGAGACCAACACCGGAGACCACTCAAGAGGAATTTGT
CAACCAAGGGTTTGTAGGCGCGATGAATATCTTTTCGGCTTTTCTTCAAATGACACTTTACCGCCGCTATGCCCA
CGACATGGTCCTGGTTCCTACTTTTGTCCCGATAACGGAGGAGGGTGCCAAGTGGCAAAACCACCCGGGTCAGAT
TGTGAACTCGCACGGGATGAACAGTGTGTTCCACCCTCACATTCAGATGGTCAAAGCGTATGCCTGAATCAAAAA
TGCCTGTATGCAAATGCAACGCTCTTCTCTCCGTGTGTAATGGAAAACACAACGTACACATTCCAAGCCTCGTAC
TCTCGTACTTCGCACACCGTTTCTGTCGTGAGACATAATTGTGTCTCTCATACCCTCCATTGTGATCCTTCGACC
CTTACCTGCGCAACTTCCAAAAAAATTGGTGAAGCTTGCGAGGCAGATTTCCAATGCGAAACGGTTGCATGTGAA
CGAGGGGTATGTTATCCTCGAGCAGACAGTCCGAATCAAGTTCCGGTTTGGCAAGTCTTGATCACTGTTATCGCT
ATCATTACCGCTATGATAGTAACCATCTTCGTTTTGATATTCAATCATCGTCGGCGCAAATTAAAAAAATTCAGA
GAATTGAGGGAGTATTACGTTGAACAACTCAGTCTTCGACGTACAATCATAGCGATGCATACCACCACAATTGAA
AGGGGAAAATCGTAG
Gene >AgabiH97|088130
ATGTCGCGCAAGTGCTTGTGGCTTTTCGGCTTCCTGTTGACTTTTGCGCGTCTGGATAGTGCCATTGGCAACTGT
AATCCACTTCACGATCGTCTCGACCCAATTTCTCACAAATTTGTCTCCTCATGCCCTGATTCCATGTATTGCGCC
CCTTTGGATGGAACTGTCGCTCTCCAAGAGTCAACACCTTTGATGGCTAGTCGTCTAACTCGTATTAAATCAAAG
CCGCCTTCGCATCAGCGCCCTTCAAACGAACCGTCCGCGGAGACCAACACCGGAGACCACTCAAGAGGAATTTGT
CAACCAAGGGTTTGTAGGCGCGATGAATATCTTTTCGGCTTTTCTTCAAATGACACTTTACCGCCGCTATGCCCA
CGACATGGTCCTGGTTCCTACTTTTGTCCCGATAACGGAGGAGGGTGCCAAGTGGCAAAACCACCCGGGTCAGAT
TGTGAACTCGCACGGGATGAACAGTGTGTTCCACCCTCACATTCAGATGGTCAAAGCGTATGCCTGAATCAAAAA
TGCCTGTGCGTCGAACAGCATTATGTTATCTTTCTTTACAATAGATTTACGTTCGTTCCTCTTTTTCCTTTTACA
GGTATGCAAATGCAACGCTCTTCTCTCCGTGTGTAATGGAAAACACAACGTACACATTCCAAGCCTCGTACTCTC
GTACTTCGCACACCGTTTCTGTCGTGAGACATAATTGTGTCTCTCATACCCTCCATTGTGATCCTTCGACCCTTA
CCTGCGCAACTTCCAAAAAAATTGGTGAAGCTTGCGAGGCAGATTTCCAATGCGAAACGGTATGCGAAGAGTCTG
GCCTATGTAACTTCTAACTTTTATATCTCATAGGTTGCATGTGAACGAGGGGTATGTTATCCTCGAGCAGACAGT
CCGAATCAAGTTCCGGTTTGGCAAGTCTTGATCACTGTTATCGCTATCATTACCGGTAAGACTTGATTGATACCA
AAAGCTATTACAGAGCCTTAACATGCAACAAGCTATGATAGTAACCATCTTCGTTTTGATATTCAATCATCGTCG
GCGCAAATTAAAAAAATTCAGAGAATTGAGGGAGTATTACGTTGAACAACTCAGGTCCGTAGTACGTTCGTGTTT
TGAATGGGTTTATTCCATTGTACTCAATTTATTTGGCCGTGTTGGCTGTGGTGATTTTAGTCTTCGACGTACAAT
CATAGCGATGCATACCACCACAATTGAAAGGGGAAAATCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail