Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|087970
Gene name
Locationscaffold_5:2450376..2451645
Strand+
Gene length (bp)1269
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 9.1E-14 174 264
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 7.4E-09 32 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 8 343 9.0E-27
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 7 256 3.0E-23
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 25 212 1.0E-22
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 13 216 2.0E-20
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 2 339 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 8 343 9.0E-27
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 7 256 3.0E-23
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 25 212 1.0E-22
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 13 216 2.0E-20
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 2 339 2.0E-20
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 18 316 2.0E-20
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 18 316 3.0E-20
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 27 212 5.0E-20
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 4 341 8.0E-20
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 27 339 4.0E-17
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 1 339 3.0E-16
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 31 261 1.0E-14
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 22 309 9.0E-14
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 22 309 1.0E-13
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 22 315 2.0E-13
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 21 240 2.0E-13
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 22 309 1.0E-12
sp|P0DN30|RTAI1_ARTBC Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 2 230 1.0E-12
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 28 261 1.0E-12
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 23 240 1.0E-12
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 19 212 1.0E-12
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 2 342 2.0E-12
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 22 309 3.0E-12
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 19 212 5.0E-12
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 19 212 5.0E-12
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 8 268 5.0E-12
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 1 342 6.0E-12
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 19 212 1.0E-11
sp|Q82LU9|CCRA2_STRAW Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 27 234 2.0E-11
sp|Q941I0|ENOXC_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 25 342 2.0E-11
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 19 212 2.0E-11
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 19 212 2.0E-11
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 22 309 5.0E-11
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 31 239 5.0E-11
sp|Q4J781|ADH_SULAC NAD-dependent alcohol dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=adh PE=3 SV=1 8 339 6.0E-11
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 25 342 7.0E-11
sp|Q54II4|RT4I1_DICDI Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=rtn4ip1 PE=3 SV=1 27 205 8.0E-11
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 22 309 9.0E-11
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 22 309 2.0E-10
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 25 342 4.0E-10
sp|Q8U259|TDH_PYRFU Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 26 261 9.0E-10
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 32 258 1.0E-09
sp|Q9UYX0|TDH_PYRAB Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 26 261 1.0E-09
sp|O58389|TDH_PYRHO Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 26 261 3.0E-09
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 21 207 5.0E-09
sp|Q53865|CCR_STRCU Crotonyl-CoA reductase OS=Streptomyces collinus GN=ccr PE=1 SV=1 27 234 8.0E-09
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 8 239 1.0E-08
sp|O74822|YBJB_SCHPO Zinc-type alcohol dehydrogenase-like protein C337.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.11 PE=3 SV=1 27 265 2.0E-08
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 33 258 1.0E-07
sp|O35045|YJMD_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 33 306 1.0E-07
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 8 342 2.0E-07
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 5 143 2.0E-07
sp|O07615|YHFP_BACSU Putative quinone oxidoreductase YhfP OS=Bacillus subtilis (strain 168) GN=yhfP PE=1 SV=1 21 218 2.0E-07
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 26 307 9.0E-07
sp|O13309|ADH2_PICST Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 1 264 1.0E-06
sp|Q9Z9U1|DHSO_BACHD Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 19 224 1.0E-06
sp|Q15ZU4|TDH_PSEA6 L-threonine 3-dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tdh PE=3 SV=1 21 305 4.0E-06
sp|A4JKG7|TDH_BURVG L-threonine 3-dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tdh PE=3 SV=1 8 305 5.0E-06
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 36 203 5.0E-06
sp|Q38ZS8|TDH_BURL3 L-threonine 3-dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tdh PE=3 SV=1 8 305 6.0E-06
sp|A9AR24|TDH_BURM1 L-threonine 3-dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=tdh PE=3 SV=1 8 305 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|087970
MALPKEHKALYLDSKHASFAISNNATPKPGPGQLLIKVKAAGLNPIDWKVQKYGIFVQNYPTILGIDIAGDVSDV
GKGVEGFANGDRVITHGLFGITSGGFQEYVLGLPTHTAKVPSNISYDQAGALPSTVGAAYLGLYNIKPDGLGFTT
PLDNNGRGKYNDVPLLIFGGATNVGQYAIQFAKLSGFMPIITTASLRHEDHLKTLGAHKVIDRHASYEILSQEVF
ATTSQPIEYILDAVSIPQTQQMAYDILAPGGQLQLVQAPEISPCSEKDVGFTKGLRSLPENKEAFTTLYNHLTEL
LQNGLIKPVRVEVIPGGLAGVSSGLERLANDQISGVKLIVHPDQTV*
Coding >AgabiH97|087970
ATGGCGCTCCCCAAGGAACATAAAGCCCTCTATCTTGATTCCAAACATGCCAGTTTCGCGATTTCCAACAATGCC
ACCCCGAAACCCGGCCCAGGACAACTACTCATAAAGGTCAAAGCCGCCGGGTTAAATCCTATCGACTGGAAGGTC
CAAAAGTACGGCATATTCGTTCAGAATTATCCCACCATTCTGGGAATAGATATTGCCGGAGACGTGTCAGATGTT
GGAAAAGGAGTGGAAGGTTTTGCGAACGGTGATCGAGTAATCACGCATGGGTTATTCGGCATTACTTCGGGAGGT
TTTCAGGAGTATGTTCTTGGCTTACCGACTCATACCGCAAAAGTCCCGTCCAACATCTCATATGATCAGGCAGGA
GCTCTTCCGTCTACGGTTGGGGCTGCCTATTTGGGGTTATACAACATCAAACCAGACGGTCTTGGGTTCACTACT
CCGTTGGATAACAACGGAAGAGGAAAGTACAATGATGTTCCCTTGTTGATTTTTGGGGGAGCAACGAATGTTGGA
CAATATGCTATCCAGTTTGCCAAACTGTCTGGCTTCATGCCGATAATCACGACCGCCTCACTTAGACATGAAGAT
CATTTGAAAACTCTAGGTGCTCATAAGGTCATTGATCGTCATGCTTCGTATGAGATTCTAAGCCAAGAAGTGTTT
GCAACGACATCCCAGCCAATCGAATACATTCTCGATGCTGTTTCAATCCCACAAACCCAACAGATGGCTTATGAT
ATACTCGCACCCGGTGGTCAACTGCAGCTAGTGCAAGCTCCTGAAATATCTCCCTGTTCAGAGAAGGATGTCGGG
TTTACGAAAGGTCTACGTTCCTTACCCGAGAATAAGGAAGCATTCACAACATTGTACAATCATTTGACGGAACTT
TTACAAAATGGATTGATCAAGCCTGTTCGCGTTGAGGTTATTCCGGGAGGCTTAGCGGGTGTATCGAGTGGACTA
GAGCGGCTTGCGAATGATCAAATTTCTGGTGTAAAACTTATTGTTCATCCCGACCAAACTGTCTAG
Transcript >AgabiH97|087970
ATGGCGCTCCCCAAGGAACATAAAGCCCTCTATCTTGATTCCAAACATGCCAGTTTCGCGATTTCCAACAATGCC
ACCCCGAAACCCGGCCCAGGACAACTACTCATAAAGGTCAAAGCCGCCGGGTTAAATCCTATCGACTGGAAGGTC
CAAAAGTACGGCATATTCGTTCAGAATTATCCCACCATTCTGGGAATAGATATTGCCGGAGACGTGTCAGATGTT
GGAAAAGGAGTGGAAGGTTTTGCGAACGGTGATCGAGTAATCACGCATGGGTTATTCGGCATTACTTCGGGAGGT
TTTCAGGAGTATGTTCTTGGCTTACCGACTCATACCGCAAAAGTCCCGTCCAACATCTCATATGATCAGGCAGGA
GCTCTTCCGTCTACGGTTGGGGCTGCCTATTTGGGGTTATACAACATCAAACCAGACGGTCTTGGGTTCACTACT
CCGTTGGATAACAACGGAAGAGGAAAGTACAATGATGTTCCCTTGTTGATTTTTGGGGGAGCAACGAATGTTGGA
CAATATGCTATCCAGTTTGCCAAACTGTCTGGCTTCATGCCGATAATCACGACCGCCTCACTTAGACATGAAGAT
CATTTGAAAACTCTAGGTGCTCATAAGGTCATTGATCGTCATGCTTCGTATGAGATTCTAAGCCAAGAAGTGTTT
GCAACGACATCCCAGCCAATCGAATACATTCTCGATGCTGTTTCAATCCCACAAACCCAACAGATGGCTTATGAT
ATACTCGCACCCGGTGGTCAACTGCAGCTAGTGCAAGCTCCTGAAATATCTCCCTGTTCAGAGAAGGATGTCGGG
TTTACGAAAGGTCTACGTTCCTTACCCGAGAATAAGGAAGCATTCACAACATTGTACAATCATTTGACGGAACTT
TTACAAAATGGATTGATCAAGCCTGTTCGCGTTGAGGTTATTCCGGGAGGCTTAGCGGGTGTATCGAGTGGACTA
GAGCGGCTTGCGAATGATCAAATTTCTGGTGTAAAACTTATTGTTCATCCCGACCAAACTGTCTAG
Gene >AgabiH97|087970
ATGGCGCTCCCCAAGGAACATAAAGCCCTCTATCTTGATTCCAAACATGCCAGTTTCGCGATTTCCAACAATGCC
ACCCCGAAACCCGGCCCAGGACAACTACTCATAAAGGTCAAAGCCGCCGGGTTAAATCCTATCGACTGGAAGGTC
CAAAAGTACGGCATATTCGTTCAGAATTATCCCACCATTCTGGGAATAGATATTGCCGGAGACGTGTCAGATGTT
GGAAAAGGAGTGGAAGGTTTTGCGAACGGTGATCGAGTGTGAGTGAAATCTTTCGTCTGCAAAATAAAAAAAATG
AAATGTATCATGGCTTGACATTGCAACGTTTTAGAATCACGCATGGGTTATTCGGCATTACTTCGGGAGGTTTTC
AGGAGTATGTTCTTGGCTTACCGACTCATACCGCAAAAGTTCGTTTATCTTTTTGATATTTATACCTATATCAAT
TGTCGCCATACCAGGTCCCGTCCAACATCTCATATGATCAGGCAGGAGCTCTTCCGTCTACGGTTGGGGCTGCCT
ATTTGGGGTTATACAACATCAAACCAGACGGTCTTGGGTTCACTACTCCGTTGGATAACAACGGAAGAGGAAAGT
ACAATGATGTTCCCTTGTTGATTTTTGGGGGAGCAACGAATGTTGGACAATATGGTACGTTGTCCTTATTGTTAT
GTTCCACCCTCGTAGCTAAGAATGGTCCTTGAGCTATCCAGTTTGCCAAACTGTCTGGCTTCATGCCGATAATCA
CGACCGCCTCACTTAGACATGAAGATCATTTGAAAACTCTAGGTGCTCATAAGGTCATTGATCGTCATGCTTCGT
ATGAGATTCTAAGCCAAGAAGTGTTTGCAACGACATCCCAGCCAATCGAATACATTCTCGATGCTGTTTCAATCC
CACAAACCCAACAGATGGCTTATGATATACTCGCACCCGGTGGTCAACTGCAGCTAGTGCAAGCTCCTGAAATAT
CTCCCTGTTCAGAGAAGGATGTCGGGTTTACGAAAGGTCTACGTTCCTTACCCGAGAATAAGGAAGCATTCACAA
CATTGTACAATCATTTGACGGAACTTTTACAAAATGGATTGATCAAGGTACGTTTATTCGCTTTGAAAATACTCG
TCGAGATGCTAGCAACTTCATTAGCCTGTTCGCGTTGAGGTTATTCCGGGAGGCTTAGCGGGTGTATCGAGTGGA
CTAGAGCGGCTTGCGAATGATCAAATTTCTGGTGTAAAACTTATTGTTCATCCCGACCAAACTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail