Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|087950
Gene name
Locationscaffold_5:2444973..2447224
Strand+
Gene length (bp)2251
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 2.9E-06 91 278

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 52 441 2.0E-89
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 52 441 2.0E-89
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 55 453 2.0E-86
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 52 426 1.0E-39

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 99 121 22
2 128 150 22
3 165 187 22
4 199 221 22
5 257 276 19
6 297 315 18
7 325 347 22
8 368 385 17
9 435 457 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|087950
MVSELPSVCLSPYFNIPDLTAREYVQQWAEPCLKQDLGCSILSHVIADEDDCRIGMYNAISGLGGSGQLDSTVAA
NATVALLAATAASALFFVPPIFDASIFACLLIGGWTYPLYSGSLLCYNHTNNAAFVIASGAILGIGASFLWVAQG
AIMVSYPLPDQKGRAIALFWVVFNLGGGIGSFISFALNFNSTAGTVTDGTYGAFIAIMAFGWLFSVSIAPPHKVV
RKDGTMAGSRPEKSANFTAAIHREVNNFVTSLGNWRILLLIPAFFCANFFYSYQQNSVNGDIFTLRTRSLNGSMY
WIAQMFGGLLIGFLLDLKYLTRPQRALLGWVFVLVTGFAIWGGGLAFQRWANGIGRKQWLDFSDSRTYIGPFWLY
FFYGAFDAFWQSYCYWLMASLAESPAAAAKFVGLYKTFQATGGAVAWRINALKYPPLTQFAINWGLFGGALLIAL
PTVLSITASPLLRAKQDESEQDESGKSPVIESSKDDA*
Coding >AgabiH97|087950
ATGGTTTCGGAACTACCCTCCGTTTGTCTGTCACCCTACTTCAACATCCCCGACTTGACGGCTAGAGAATACGTC
CAACAATGGGCCGAACCATGTCTGAAGCAAGATTTGGGTTGTTCGATCCTTTCTCATGTTATCGCTGACGAAGAC
GACTGTCGAATAGGAATGTACAACGCTATTAGTGGTTTGGGAGGGTCTGGTCAGCTCGATAGCACAGTCGCGGCC
AATGCAACCGTCGCTCTGTTAGCAGCAACGGCGGCATCTGCGCTCTTTTTTGTTCCTCCGATCTTTGATGCAAGT
ATCTTCGCGTGTCTACTGATAGGTGGCTGGACTTACCCATTGTACTCCGGATCACTCCTATGCTACAACCACACG
AACAATGCGGCTTTTGTCATTGCATCTGGAGCAATCCTTGGTATCGGTGCATCTTTCCTTTGGGTAGCGCAAGGA
GCTATCATGGTTTCGTATCCTCTACCAGATCAGAAAGGACGAGCCATCGCTCTGTTCTGGGTTGTATTTAACCTT
GGAGGAGGTATTGGGTCCTTCATTTCGTTCGCCCTCAATTTCAACTCCACGGCTGGCACAGTTACTGATGGAACA
TATGGCGCTTTCATAGCTATCATGGCCTTTGGCTGGCTGTTTTCCGTCTCGATTGCCCCGCCACACAAGGTTGTC
AGAAAGGATGGTACGATGGCTGGATCACGCCCTGAGAAATCGGCGAATTTTACCGCGGCCATCCATCGCGAAGTC
AACAACTTTGTAACGTCACTGGGAAATTGGAGAATTCTTCTACTTATTCCGGCATTCTTCTGTGCCAACTTCTTC
TACTCTTACCAACAGAATAGCGTCAATGGTGATATTTTCACTTTGAGAACACGATCTTTAAATGGATCTATGTAT
TGGATTGCCCAAATGTTCGGTGGCCTACTTATTGGGTTTTTACTCGATCTTAAATATCTAACTCGACCTCAACGC
GCTCTGCTCGGATGGGTTTTCGTACTTGTAACTGGGTTTGCTATATGGGGAGGTGGGCTTGCATTCCAAAGATGG
GCTAACGGGATTGGAAGGAAGCAGTGGTTAGACTTCTCCGATTCAAGGACATACATCGGTCCTTTCTGGTTATAC
TTCTTTTATGGTGCTTTTGATGCTTTCTGGCAATCTTACTGTTATTGGTTGATGGCTTCGTTAGCCGAGTCCCCC
GCCGCTGCGGCCAAGTTCGTTGGTTTATACAAGACGTTCCAAGCAACAGGTGGTGCAGTTGCGTGGAGAATTAAC
GCATTGAAGTATCCTCCTTTGACCCAATTTGCGATCAATTGGGGACTCTTCGGGGGCGCATTGCTAATTGCGTTA
CCAACTGTTCTTTCTATCACGGCTTCTCCATTGCTCCGCGCGAAACAGGATGAAAGTGAGCAAGACGAGTCCGGA
AAATCGCCGGTCATCGAATCTTCGAAGGACGACGCCTAA
Transcript >AgabiH97|087950
ATGGTTTCGGAACTACCCTCCGTTTGTCTGTCACCCTACTTCAACATCCCCGACTTGACGGCTAGAGAATACGTC
CAACAATGGGCCGAACCATGTCTGAAGCAAGATTTGGGTTGTTCGATCCTTTCTCATGTTATCGCTGACGAAGAC
GACTGTCGAATAGGAATGTACAACGCTATTAGTGGTTTGGGAGGGTCTGGTCAGCTCGATAGCACAGTCGCGGCC
AATGCAACCGTCGCTCTGTTAGCAGCAACGGCGGCATCTGCGCTCTTTTTTGTTCCTCCGATCTTTGATGCAAGT
ATCTTCGCGTGTCTACTGATAGGTGGCTGGACTTACCCATTGTACTCCGGATCACTCCTATGCTACAACCACACG
AACAATGCGGCTTTTGTCATTGCATCTGGAGCAATCCTTGGTATCGGTGCATCTTTCCTTTGGGTAGCGCAAGGA
GCTATCATGGTTTCGTATCCTCTACCAGATCAGAAAGGACGAGCCATCGCTCTGTTCTGGGTTGTATTTAACCTT
GGAGGAGGTATTGGGTCCTTCATTTCGTTCGCCCTCAATTTCAACTCCACGGCTGGCACAGTTACTGATGGAACA
TATGGCGCTTTCATAGCTATCATGGCCTTTGGCTGGCTGTTTTCCGTCTCGATTGCCCCGCCACACAAGGTTGTC
AGAAAGGATGGTACGATGGCTGGATCACGCCCTGAGAAATCGGCGAATTTTACCGCGGCCATCCATCGCGAAGTC
AACAACTTTGTAACGTCACTGGGAAATTGGAGAATTCTTCTACTTATTCCGGCATTCTTCTGTGCCAACTTCTTC
TACTCTTACCAACAGAATAGCGTCAATGGTGATATTTTCACTTTGAGAACACGATCTTTAAATGGATCTATGTAT
TGGATTGCCCAAATGTTCGGTGGCCTACTTATTGGGTTTTTACTCGATCTTAAATATCTAACTCGACCTCAACGC
GCTCTGCTCGGATGGGTTTTCGTACTTGTAACTGGGTTTGCTATATGGGGAGGTGGGCTTGCATTCCAAAGATGG
GCTAACGGGATTGGAAGGAAGCAGTGGTTAGACTTCTCCGATTCAAGGACATACATCGGTCCTTTCTGGTTATAC
TTCTTTTATGGTGCTTTTGATGCTTTCTGGCAATCTTACTGTTATTGGTTGATGGCTTCGTTAGCCGAGTCCCCC
GCCGCTGCGGCCAAGTTCGTTGGTTTATACAAGACGTTCCAAGCAACAGGTGGTGCAGTTGCGTGGAGAATTAAC
GCATTGAAGTATCCTCCTTTGACCCAATTTGCGATCAATTGGGGACTCTTCGGGGGCGCATTGCTAATTGCGTTA
CCAACTGTTCTTTCTATCACGGCTTCTCCATTGCTCCGCGCGAAACAGGATGAAAGTGAGCAAGACGAGTCCGGA
AAATCGCCGGTCATCGAATCTTCGAAGGACGACGCCTAA
Gene >AgabiH97|087950
ATGGTTTCGGAACTACCCTCCGTTTGTCTGTCACCCTACTTCAACATCCCCGACTTGACGGCTAGAGAATACGTC
CAACAATGGGCCGAACCATGTCTGAAGTATATCGGTCGCCAATGACTCAAGTACTGCTTATCTCTATCGTGTGCT
TTTGTTGTCCAGGCAAGATTTGGGTTGTTCGATCCTTTCTCATGTTATCGCTGACGAAGACGACTGTCGAATAGG
AATGTACAACGCTATTAGTGGTTTGGGAGGGTCTGGTCAGCTCGATAGCACAGTCGCGGCCAATGCAACCGTCGC
TCTGTTAGCAGCAACGGCGGCATCTGCGCTCTTTTTTGTTCCTCCGATCTTTGATGCAAGTATCTTCGGTACCGA
AATACCGATCACTAATCCGCAAATTTAATAGATGCTCGGTCCGAAAGCGTGTCTACTGATAGGTTGGTTTAACTT
TCACGATGAAACTTCCCGGCGGTGACAGGCCCTGCTTTACATAGGTGGCTGGACTTACCCATTGTACTCCGGATC
ACTCCTATGCTACAACCACACGAACAATGCGGCTTTTGTCATTGCATCTGGAGCAATCCTTGGTATCGGTGCATC
TTTCCTTTGGGTAGCGCAAGGAGCTGTTGAGTTTTTCTCGTCTTGATTCATTCTTGATGTCTGATATACTTCCAT
GCAGATCATGGTTTCGTATCCTCTACCAGATCAGAAAGGACGAGCCATCGCTCTGTTCTGGGTAAGTGTTACCCT
CTGTTTGTTCATTGAAAAAGACGACTGATTACAGCGAAGGTTGTATTTAACCTTGGAGGAGGTATTGGGTCCTTC
ATTTCGTTCGCCCTCAATTTCAACTCCACGGCTGGCACAGTTACTGATGGAACATGTGAGTCTTGATATGATATG
TTTCCTGAACGTTTGGCATTGAATCCATTATCATGTCAGATGGCGCTTTCATAGCTATCATGGGTGAGATGAAGA
TAAACCTTGCGATTCTCGTATCTGATACTAATTCTGACATTAGCCTTTGGCTGGCTGTTTTCCGTCTCGATTGCC
CCGCCACACAAGGTTGTCAGAAAGGATGGTACGATGGCTGGATCACGCCCTGAGAAATCGGCGAATTTTACCGCG
GCCATCCATCGCGAAGTCAACAACTTTGTAACGTCACTGGGAAATTGGAGAATTCTTCTACTTATTCCGGCATTC
TTCTGTGCCAACTTCTTCTACTCTTACCAACAGAATAGCGTCAATGGTATGTACCACTTGCTTCGTCTGTGTTAC
ATTGATCATCCATTTACCAACACTCTCAGGTGATATTTTCACTTTGAGAACACGATCTTTAAATGGATCTATGTA
TTGGATTGCCCAAATGGTGAGTGCGAAGCTAGCATGTGTATTCAAATCTTCAATTTGGGTGTGATCACATCAGTT
CGGTGGCCTACTTATTGGGTTTTTACTCGATCTTAAATATCTAACTCGACCTCAACGCGCTCTGCTCGGATGGGT
TTTCGTACTTGTAACTGGGTTTGCTATATGGGGAGGTGAGTTGAATTGTTCGAGAACCGTTTATTATTGAAACGA
GATATCTTATCTAGGTGGGCTTGCATTCCAAAGATGGGCTAACGGGATTGGAAGGAAGCAGTGGTTAGACTTCTC
CGATTCAAGGACATACATCGGTCCTTTCTGGTTGTAAGCGTTATTCTCAAAAACGGAAGAATTACATGCTGACGC
TGAGGAACTTTCAGATACTTCTTTTATGGTGCTTTTGATGCTTTCTGGCAAGTACGTGGGGCGGTTTCTTGAGTA
TTGTGCTTACTGGTGCAGTCATTGATATGAGTAATAGTCTTACTGTTATTGGTTGATGGCTTCGTTAGCCGAGTC
CCCCGCCGCTGCGGCCAAGTTCGTTGGTTGTGCGTATTCAAATACTTCATCAAGCTTCTCAAAGTGGGCTGACGA
TTTGCGCAGTATACAAGACGTTCCAAGCAACAGGTGGTGCAGTTGCGTGGAGAATTAACGCATTGAAGTGTGAGT
GTGTGAAGCTTCAAATAGGCCACATTTACTAAAGCTTTGTCAAAAAGATCCTCCTTTGACCCAATTTGCGATCAA
TTGGGGACTCTTCGGGGGCGCATTGCTAATTGCGTTACCAACTGTTCTTTCTATCACGGCTTCTCCATTGCTCCG
CGCGAAACAGGATGAAAGTGAGCAAGACGAGTCCGGAAAATCGCCGGTCATCGAATCTTCGAAGGACGACGCCTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail