Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|087930
Gene name
Locationscaffold_5:2436202..2441618
Strand+
Gene length (bp)5416
Transcript length (bp)4386
Coding sequence length (bp)4386
Protein length (aa) 1462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17846 XRN_M Xrn1 helical domain 1.2E-99 274 723
PF03159 XRN_N XRN 5'-3' exonuclease N-terminus 4.0E-95 1 227
PF18332 XRN1_D1 Exoribonuclease Xrn1 D1 domain 6.1E-71 766 957
PF18334 XRN1_D2_D3 Exoribonuclease Xrn1 D2/D3 domain 6.0E-31 961 1047
PF18194 Xrn1_D3 Exoribonuclease 1 Domain-3 1.1E-24 1129 1200
PF18129 SH3_12 Xrn1 SH3-like domain 1.7E-21 1209 1273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40383|XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo2 PE=1 SV=1 1 1283 0.0E+00
sp|Q9FQ03|XRN3_ARATH 5'-3' exoribonuclease 3 OS=Arabidopsis thaliana GN=XRN3 PE=2 SV=1 1 723 5.0E-150
sp|Q74ZA0|XRN2_ASHGO 5'-3' exoribonuclease 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAT1 PE=3 SV=4 1 714 9.0E-146
sp|Q6BNU7|XRN2_DEBHA 5'-3' exoribonuclease 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAT1 PE=3 SV=4 1 725 5.0E-144
sp|Q02792|XRN2_YEAST 5'-3' exoribonuclease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAT1 PE=1 SV=3 1 725 5.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40383|XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo2 PE=1 SV=1 1 1283 0.0E+00
sp|Q9FQ03|XRN3_ARATH 5'-3' exoribonuclease 3 OS=Arabidopsis thaliana GN=XRN3 PE=2 SV=1 1 723 5.0E-150
sp|Q74ZA0|XRN2_ASHGO 5'-3' exoribonuclease 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAT1 PE=3 SV=4 1 714 9.0E-146
sp|Q6BNU7|XRN2_DEBHA 5'-3' exoribonuclease 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAT1 PE=3 SV=4 1 725 5.0E-144
sp|Q02792|XRN2_YEAST 5'-3' exoribonuclease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAT1 PE=1 SV=3 1 725 5.0E-142
sp|P97789|XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus GN=Xrn1 PE=1 SV=1 1 365 7.0E-141
sp|Q8IZH2|XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens GN=XRN1 PE=1 SV=1 1 365 9.0E-141
sp|Q5AMG5|XRN2_CANAL 5'-3' exoribonuclease 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAT1 PE=3 SV=3 1 723 1.0E-140
sp|P22147|XRN1_YEAST 5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XRN1 PE=1 SV=1 501 1280 2.0E-140
sp|Q2GNZ6|XRN2_CHAGB 5'-3' exoribonuclease 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RAT1 PE=3 SV=3 1 817 2.0E-140
sp|P40848|XRN2_SCHPO 5'-3' exoribonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dhp1 PE=1 SV=1 1 723 4.0E-139
sp|Q4HWE2|XRN2_GIBZE 5'-3' exoribonuclease 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAT1 PE=3 SV=3 1 744 4.0E-139
sp|Q8TFZ1|XRN2_ASPFU 5'-3' exoribonuclease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rat1 PE=3 SV=4 1 723 9.0E-138
sp|Q5BFH3|XRN2_EMENI 5'-3' exoribonuclease 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rat1 PE=3 SV=3 1 717 2.0E-137
sp|Q2UCP5|XRN2_ASPOR 5'-3' exoribonuclease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rat1 PE=3 SV=3 1 717 6.0E-137
sp|P22147|XRN1_YEAST 5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XRN1 PE=1 SV=1 1 383 7.0E-137
sp|Q8WZX5|XRN2_NEUCR 5'-3' exoribonuclease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=exr-1 PE=3 SV=3 1 717 2.0E-132
sp|Q9FQ02|XRN2_ARATH 5'-3' exoribonuclease 2 OS=Arabidopsis thaliana GN=XRN2 PE=2 SV=1 1 715 9.0E-124
sp|Q6C961|XRN2_YARLI 5'-3' exoribonuclease 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAT1 PE=3 SV=3 1 715 6.0E-123
sp|Q9U299|XRN2_CAEEL 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis elegans GN=xrn-2 PE=1 SV=2 1 784 2.0E-121
sp|P97789|XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus GN=Xrn1 PE=1 SV=1 530 1286 5.0E-103
sp|Q8IZH2|XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens GN=XRN1 PE=1 SV=1 553 1276 3.0E-102
sp|Q9H0D6|XRN2_HUMAN 5'-3' exoribonuclease 2 OS=Homo sapiens GN=XRN2 PE=1 SV=1 1 362 4.0E-98
sp|Q5ZIP4|XRN2_CHICK 5'-3' exoribonuclease 2 OS=Gallus gallus GN=XRN2 PE=2 SV=1 1 358 4.0E-98
sp|Q5R4L5|XRN2_PONAB 5'-3' exoribonuclease 2 OS=Pongo abelii GN=XRN2 PE=2 SV=1 1 362 7.0E-98
sp|Q9DBR1|XRN2_MOUSE 5'-3' exoribonuclease 2 OS=Mus musculus GN=Xrn2 PE=1 SV=1 1 362 3.0E-97
sp|Q9VM71|XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster GN=Rat1 PE=1 SV=2 1 382 2.0E-96
sp|Q60SG7|XRN2_CAEBR 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis briggsae GN=xrn-2 PE=3 SV=2 1 414 5.0E-95
sp|Q6FKN6|XRN2_CANGA 5'-3' exoribonuclease 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAT1 PE=3 SV=3 1 356 5.0E-90
sp|Q6CKX0|XRN2_KLULA 5'-3' exoribonuclease 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAT1 PE=3 SV=3 1 356 1.0E-87
sp|Q4P149|XRN2_USTMA 5'-3' exoribonuclease 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAT1 PE=3 SV=3 1 352 7.0E-86
sp|Q9FQ04|XRN4_ARATH 5'-3' exoribonuclease 4 OS=Arabidopsis thaliana GN=XRN4 PE=2 SV=1 1 354 2.0E-85
sp|P0CL89|XRN2_CRYNB 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAT1 PE=3 SV=1 1 358 1.0E-83
sp|P0CL88|XRN2_CRYNJ 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAT1 PE=3 SV=1 1 358 1.0E-83
sp|P0CL88|XRN2_CRYNJ 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAT1 PE=3 SV=1 554 725 2.0E-46
sp|P0CL89|XRN2_CRYNB 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAT1 PE=3 SV=1 554 725 2.0E-46
sp|Q9DBR1|XRN2_MOUSE 5'-3' exoribonuclease 2 OS=Mus musculus GN=Xrn2 PE=1 SV=1 544 723 5.0E-44
sp|Q5ZIP4|XRN2_CHICK 5'-3' exoribonuclease 2 OS=Gallus gallus GN=XRN2 PE=2 SV=1 544 723 5.0E-44
sp|Q9H0D6|XRN2_HUMAN 5'-3' exoribonuclease 2 OS=Homo sapiens GN=XRN2 PE=1 SV=1 544 723 7.0E-44
sp|Q5R4L5|XRN2_PONAB 5'-3' exoribonuclease 2 OS=Pongo abelii GN=XRN2 PE=2 SV=1 544 723 2.0E-43
sp|Q9FQ04|XRN4_ARATH 5'-3' exoribonuclease 4 OS=Arabidopsis thaliana GN=XRN4 PE=2 SV=1 575 715 4.0E-43
sp|Q9VM71|XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster GN=Rat1 PE=1 SV=2 547 725 1.0E-42
sp|Q4P149|XRN2_USTMA 5'-3' exoribonuclease 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAT1 PE=3 SV=3 554 732 8.0E-42
sp|Q60SG7|XRN2_CAEBR 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis briggsae GN=xrn-2 PE=3 SV=2 554 784 2.0E-38
sp|Q9QSK5|EXON_IIV6 Putative exonuclease 012L OS=Invertebrate iridescent virus 6 GN=IIV6-012L PE=3 SV=1 1 363 1.0E-35
sp|Q197A1|EX0N_IIV3 Putative exonuclease 059L OS=Invertebrate iridescent virus 3 GN=IIV3-059L PE=3 SV=1 1 315 1.0E-27
sp|Q197A1|EX0N_IIV3 Putative exonuclease 059L OS=Invertebrate iridescent virus 3 GN=IIV3-059L PE=3 SV=1 576 721 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0004527 exonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004518 nuclease activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|087930
MGIPKFFRYISERYPLTSQLIQENKIPEFDNLYLDFNGIIHNCSHPNDEDAHFRLSEDQIFTSIFAYVDHLFGKI
KPKKLFFMAVDGVAPRAKMNQQRSRRFRTAKEAKDVREKAEKKGEKLPDEKAFDSNCITPGTLFMARLSEQLRYF
VNKKISEDANWRDIEVVLSGHEVPGEGEHKIMEYIRLSRAQPDYNPNIRHCLYGLDADLIMLGLLSHDPHFCLLR
EEVKFGPKTKQKNNTSLESVNFYLLHLCLMREYLDLEFRDIESTLPFGYSLERVIDDFILLAVFVGNDFLPNLPD
LHIHENGLEKLFEVYKKVLPGLEGYINEGGVINVKRLQVILDEMARWEQDVFEKEYADLNWFKGKQAKHVKEMEM
GRKRSSLALTKPQRDIFAKVKGYILASRKGPLSKAGKLTMLNTFPASERAFVTRLAEELHLSLRFDEFDENDNNI
LTLTLPGVQEDDEDGGVSKNEEEKEANGTSSSDAEVVEESSGGPPDSDWEDTSGDDDDADNEESRIAVDRVLNKY
DKAPAFDDEEGGGFDARHERSIREKMDEWKRGYYQGKMEISYDDPKGMGDLVYRYVEGLQWVMHYYYSGVASWGW
FYNYHYAPRISDLRGVDKMTFNFELGTPFKPFQQLMGVLPSASMELIPEPYRELMYDPNSPILDFYPVEFESDLN
GKKAEWEAIVKIPFIDEVRLLKAMATREHRLTTEERKRNSWGTSTKFIYNPGESTVYPSSLPGFFPTLQRCHCRM
EDFDLPTLDGLHLVPGLLDGVSLGIESLAGFPSLKTLPHTTVLDFHRVNVHGQESKNKSMVVRIENPHEGSNSNE
MANKMVGERIFMGWPYLQEGLVVALSDGLFSYEKAALVEGDAPKVISNPHLQHGINHWQTKAERIESMYSKKYGV
LTGRVEVLLHIRPLKGLKRLENGALVKDYEDADKEIEQALQMCLSEVVSEDPRFLEREPPPLNVEFPDGSKVFFL
GEHAYGVAAQVTGTTDTSLSVVLAFFPSEKAEMEKFKAVVNNRRASRYIPSFRAAESLRISPRALSRITSSFMVV
TGHDKQKINLGLSLKFEAKSLKVVDYTRKDGRHWEYSEKAMELLREYKAAFPEIFRCLDADSDAMALASDVFSES
SKPDERVREIKAWLKQKGVTNLEPVSLFCDQLSKETVVELEQLADSLTKSKSPSDFKKAIVKGIPRQAVLKPAHA
VYRLQNQWFGLGDRVAMVRDSGAVPLSVKGLVIGINANSMDVLWDVPFMSGVTLSDRCSPYRGMTVEFNSCLNLS
NPQFVTSTNPKAPPPPPITTPFNPRHGPYPAIQPGPGQRGASGFRPALQSHAGPAGHVQIMNNPNRARGSHHANG
RGGHPGHPTIPANVIAARGRGGGAVSGSQTRMNGSGRSSQTPTSPTSSSRVNGYSNASSHISSDPAAETTTPSRG
RGRGFMPRGRGFIPSPYRGGSSGRGRGRGSFTPIPS*
Coding >AgabiH97|087930
ATGGGTATTCCCAAGTTTTTCCGATACATTTCTGAACGCTACCCTTTGACCTCCCAGCTAATCCAAGAGAACAAG
ATTCCGGAATTTGATAATCTATACCTTGATTTCAATGGCATCATCCATAACTGTTCTCATCCCAATGACGAAGAC
GCTCATTTCCGACTTTCTGAAGACCAAATATTCACCTCGATCTTTGCCTATGTCGACCATCTCTTCGGCAAAATC
AAGCCGAAAAAACTCTTCTTCATGGCCGTTGATGGCGTTGCGCCTCGCGCAAAGATGAACCAACAACGGAGCAGG
CGTTTCCGGACTGCAAAGGAAGCGAAAGATGTCAGGGAAAAGGCGGAAAAGAAGGGTGAAAAATTACCTGATGAG
AAAGCTTTCGACAGCAACTGTATTACCCCTGGCACGCTCTTCATGGCTCGCTTGTCGGAACAGTTGCGTTATTTT
GTAAACAAGAAAATCTCCGAGGATGCCAATTGGCGCGATATTGAAGTTGTATTGTCTGGTCACGAAGTACCAGGG
GAAGGTGAACACAAAATAATGGAATATATCAGGTTGTCCAGGGCACAACCAGACTACAATCCCAATATCCGGCAT
TGTTTATATGGCCTGGATGCCGACCTCATCATGCTGGGACTTTTGAGTCATGACCCTCATTTTTGTTTGTTGCGA
GAGGAGGTCAAGTTTGGCCCCAAGACGAAGCAGAAGAATAACACGAGTTTGGAGTCGGTCAACTTTTATCTGCTA
CATCTATGTTTGATGCGCGAATACCTCGACCTCGAGTTTCGAGATATTGAATCGACGTTACCGTTTGGGTATAGT
TTGGAACGTGTCATTGATGATTTTATTTTGCTTGCCGTTTTCGTTGGGAACGATTTCTTGCCTAACCTTCCCGAC
TTACACATTCATGAAAACGGATTGGAGAAGTTGTTTGAAGTGTATAAGAAGGTTTTGCCTGGTCTTGAGGGGTAT
ATCAATGAGGGTGGCGTGATCAACGTCAAGAGGCTTCAAGTCATTCTTGACGAGATGGCACGATGGGAGCAGGAT
GTTTTTGAGAAAGAGTACGCCGATTTGAATTGGTTCAAAGGCAAACAAGCAAAACATGTAAAGGAGATGGAAATG
GGTCGCAAGCGGTCTAGTCTTGCATTGACGAAACCTCAAAGAGATATCTTCGCTAAAGTCAAAGGGTATATCCTT
GCTAGTCGCAAGGGTCCTTTGTCTAAAGCGGGAAAGCTTACGATGCTTAATACGTTCCCGGCCAGTGAACGCGCT
TTCGTCACTCGGCTTGCGGAAGAGTTGCATCTCAGTCTACGATTCGATGAGTTTGACGAGAATGATAACAATATT
CTTACTTTGACTTTACCGGGTGTCCAAGAAGACGATGAAGATGGTGGTGTTAGTAAGAATGAAGAAGAGAAGGAG
GCGAATGGCACTAGTAGTTCGGATGCGGAGGTTGTTGAGGAGAGTTCTGGAGGCCCGCCGGATAGCGATTGGGAG
GATACGAGTGGCGATGATGATGACGCGGATAATGAAGAAAGCCGGATTGCTGTTGATCGAGTGTTGAACAAGTAT
GACAAGGCGCCGGCTTTTGACGATGAAGAGGGTGGCGGTTTTGATGCTCGGCACGAGAGGTCTATTAGGGAAAAG
ATGGATGAATGGAAAAGAGGTTATTATCAGGGAAAGATGGAGATTTCATATGACGATCCGAAGGGCATGGGTGAT
TTGGTGTATAGATATGTCGAGGGGCTGCAGTGGGTAATGCACTACTATTACAGTGGTGTAGCATCTTGGGGTTGG
TTCTACAACTATCATTATGCGCCGCGCATCTCAGATTTACGCGGCGTCGACAAGATGACTTTCAACTTTGAGCTC
GGTACTCCCTTCAAACCTTTCCAACAGCTGATGGGTGTCCTACCCTCCGCTAGTATGGAACTCATTCCGGAGCCG
TATCGGGAGCTCATGTATGATCCTAATTCACCTATCCTGGATTTCTACCCTGTGGAATTCGAGTCGGATCTGAAT
GGGAAGAAGGCGGAATGGGAGGCAATTGTGAAAATTCCGTTTATTGACGAAGTGAGGCTGCTCAAGGCCATGGCT
ACACGGGAACATCGGTTGACTACGGAAGAGCGCAAACGAAATTCTTGGGGAACAAGTACCAAATTTATCTACAAT
CCTGGCGAAAGCACTGTATATCCCTCGTCTCTTCCCGGATTCTTTCCGACCCTCCAGCGGTGTCATTGTAGAATG
GAGGATTTCGATCTTCCTACTCTCGATGGCCTTCACCTCGTTCCTGGACTCCTTGATGGAGTCTCTTTGGGTATT
GAATCTCTAGCAGGTTTTCCGTCACTCAAAACTCTTCCACATACCACTGTCTTGGATTTCCACCGTGTCAACGTA
CATGGTCAGGAATCTAAAAACAAATCGATGGTGGTCAGGATCGAGAATCCTCACGAGGGTTCAAATTCGAACGAA
ATGGCGAACAAGATGGTGGGGGAGAGGATTTTTATGGGATGGCCGTATCTGCAAGAAGGATTGGTTGTGGCGCTA
TCCGACGGGTTGTTCAGCTATGAAAAAGCCGCGCTTGTTGAAGGAGACGCTCCGAAAGTGATATCGAACCCGCAT
CTCCAACACGGTATCAATCACTGGCAAACCAAAGCCGAACGGATCGAGTCGATGTATTCTAAGAAGTACGGAGTG
TTGACAGGAAGAGTTGAAGTTCTATTACATATACGACCGCTGAAGGGGTTGAAGAGGTTGGAGAATGGAGCTTTG
GTTAAGGATTATGAAGATGCGGATAAGGAGATTGAGCAGGCTTTACAGATGTGTTTGAGTGAAGTCGTTTCGGAG
GATCCGAGGTTTTTGGAGAGGGAGCCGCCACCGTTGAATGTTGAGTTCCCTGACGGAAGTAAAGTGTTCTTCCTC
GGAGAACATGCGTATGGCGTGGCAGCTCAGGTGACGGGCACAACGGACACGAGTCTATCGGTTGTTCTTGCGTTC
TTCCCGTCCGAGAAAGCGGAAATGGAAAAGTTCAAAGCTGTTGTCAATAATCGGAGGGCATCGAGATACATTCCT
TCGTTCAGAGCTGCCGAGAGTTTACGAATCTCTCCGCGGGCCTTGTCAAGGATCACCTCGAGTTTCATGGTTGTG
ACAGGTCATGACAAACAAAAGATCAATCTGGGATTGAGTTTGAAATTCGAAGCGAAGTCATTGAAAGTGGTGGAT
TACACGAGGAAGGATGGCAGACATTGGGAATATAGTGAGAAGGCAATGGAGTTGCTTAGGGAGTACAAGGCCGCG
TTTCCTGAGATCTTCAGATGCTTGGATGCGGATAGTGATGCGATGGCTCTCGCATCGGATGTTTTCAGTGAGAGC
AGTAAACCCGACGAGAGGGTTCGAGAGATAAAGGCTTGGCTGAAGCAGAAAGGTGTAACAAACCTTGAACCCGTG
TCCCTCTTCTGTGATCAATTATCCAAGGAAACCGTCGTTGAGCTAGAACAATTAGCCGACTCCTTAACAAAGAGC
AAGTCGCCCTCTGATTTCAAGAAGGCTATTGTGAAGGGAATTCCGAGGCAAGCGGTTCTTAAACCTGCGCATGCC
GTCTATCGGCTCCAGAACCAATGGTTCGGGTTGGGAGATCGAGTAGCCATGGTCAGGGACTCGGGGGCTGTCCCG
TTATCGGTCAAGGGGCTTGTCATAGGGATCAATGCGAACTCGATGGATGTTCTTTGGGATGTACCCTTCATGTCC
GGTGTGACTTTGAGTGACAGATGTTCGCCATATCGCGGCATGACCGTTGAGTTTAATTCATGCCTCAACTTATCG
AATCCGCAGTTTGTCACATCCACAAACCCCAAAGCTCCGCCTCCTCCGCCTATCACCACACCCTTCAATCCGCGC
CACGGACCTTATCCCGCGATTCAACCTGGCCCTGGCCAGCGTGGAGCTTCCGGTTTCCGTCCTGCACTCCAAAGT
CACGCTGGACCGGCAGGACATGTCCAGATCATGAATAATCCTAACCGAGCGAGAGGCAGTCATCATGCGAATGGA
CGCGGTGGGCACCCTGGACACCCGACTATTCCTGCCAACGTAATTGCTGCCCGTGGTCGCGGCGGTGGAGCTGTT
TCAGGATCACAAACCCGTATGAATGGGAGCGGGCGTTCAAGTCAAACACCGACGAGTCCCACTTCTTCTAGTCGC
GTCAATGGATACAGTAACGCGTCGAGCCACATATCCTCGGATCCGGCAGCAGAGACAACGACTCCGTCCAGAGGT
CGTGGCAGAGGGTTCATGCCACGTGGCCGAGGTTTTATTCCGAGCCCGTACCGCGGAGGATCGAGTGGGAGAGGA
AGAGGTCGAGGCTCGTTTACACCAATTCCCTCTTGA
Transcript >AgabiH97|087930
ATGGGTATTCCCAAGTTTTTCCGATACATTTCTGAACGCTACCCTTTGACCTCCCAGCTAATCCAAGAGAACAAG
ATTCCGGAATTTGATAATCTATACCTTGATTTCAATGGCATCATCCATAACTGTTCTCATCCCAATGACGAAGAC
GCTCATTTCCGACTTTCTGAAGACCAAATATTCACCTCGATCTTTGCCTATGTCGACCATCTCTTCGGCAAAATC
AAGCCGAAAAAACTCTTCTTCATGGCCGTTGATGGCGTTGCGCCTCGCGCAAAGATGAACCAACAACGGAGCAGG
CGTTTCCGGACTGCAAAGGAAGCGAAAGATGTCAGGGAAAAGGCGGAAAAGAAGGGTGAAAAATTACCTGATGAG
AAAGCTTTCGACAGCAACTGTATTACCCCTGGCACGCTCTTCATGGCTCGCTTGTCGGAACAGTTGCGTTATTTT
GTAAACAAGAAAATCTCCGAGGATGCCAATTGGCGCGATATTGAAGTTGTATTGTCTGGTCACGAAGTACCAGGG
GAAGGTGAACACAAAATAATGGAATATATCAGGTTGTCCAGGGCACAACCAGACTACAATCCCAATATCCGGCAT
TGTTTATATGGCCTGGATGCCGACCTCATCATGCTGGGACTTTTGAGTCATGACCCTCATTTTTGTTTGTTGCGA
GAGGAGGTCAAGTTTGGCCCCAAGACGAAGCAGAAGAATAACACGAGTTTGGAGTCGGTCAACTTTTATCTGCTA
CATCTATGTTTGATGCGCGAATACCTCGACCTCGAGTTTCGAGATATTGAATCGACGTTACCGTTTGGGTATAGT
TTGGAACGTGTCATTGATGATTTTATTTTGCTTGCCGTTTTCGTTGGGAACGATTTCTTGCCTAACCTTCCCGAC
TTACACATTCATGAAAACGGATTGGAGAAGTTGTTTGAAGTGTATAAGAAGGTTTTGCCTGGTCTTGAGGGGTAT
ATCAATGAGGGTGGCGTGATCAACGTCAAGAGGCTTCAAGTCATTCTTGACGAGATGGCACGATGGGAGCAGGAT
GTTTTTGAGAAAGAGTACGCCGATTTGAATTGGTTCAAAGGCAAACAAGCAAAACATGTAAAGGAGATGGAAATG
GGTCGCAAGCGGTCTAGTCTTGCATTGACGAAACCTCAAAGAGATATCTTCGCTAAAGTCAAAGGGTATATCCTT
GCTAGTCGCAAGGGTCCTTTGTCTAAAGCGGGAAAGCTTACGATGCTTAATACGTTCCCGGCCAGTGAACGCGCT
TTCGTCACTCGGCTTGCGGAAGAGTTGCATCTCAGTCTACGATTCGATGAGTTTGACGAGAATGATAACAATATT
CTTACTTTGACTTTACCGGGTGTCCAAGAAGACGATGAAGATGGTGGTGTTAGTAAGAATGAAGAAGAGAAGGAG
GCGAATGGCACTAGTAGTTCGGATGCGGAGGTTGTTGAGGAGAGTTCTGGAGGCCCGCCGGATAGCGATTGGGAG
GATACGAGTGGCGATGATGATGACGCGGATAATGAAGAAAGCCGGATTGCTGTTGATCGAGTGTTGAACAAGTAT
GACAAGGCGCCGGCTTTTGACGATGAAGAGGGTGGCGGTTTTGATGCTCGGCACGAGAGGTCTATTAGGGAAAAG
ATGGATGAATGGAAAAGAGGTTATTATCAGGGAAAGATGGAGATTTCATATGACGATCCGAAGGGCATGGGTGAT
TTGGTGTATAGATATGTCGAGGGGCTGCAGTGGGTAATGCACTACTATTACAGTGGTGTAGCATCTTGGGGTTGG
TTCTACAACTATCATTATGCGCCGCGCATCTCAGATTTACGCGGCGTCGACAAGATGACTTTCAACTTTGAGCTC
GGTACTCCCTTCAAACCTTTCCAACAGCTGATGGGTGTCCTACCCTCCGCTAGTATGGAACTCATTCCGGAGCCG
TATCGGGAGCTCATGTATGATCCTAATTCACCTATCCTGGATTTCTACCCTGTGGAATTCGAGTCGGATCTGAAT
GGGAAGAAGGCGGAATGGGAGGCAATTGTGAAAATTCCGTTTATTGACGAAGTGAGGCTGCTCAAGGCCATGGCT
ACACGGGAACATCGGTTGACTACGGAAGAGCGCAAACGAAATTCTTGGGGAACAAGTACCAAATTTATCTACAAT
CCTGGCGAAAGCACTGTATATCCCTCGTCTCTTCCCGGATTCTTTCCGACCCTCCAGCGGTGTCATTGTAGAATG
GAGGATTTCGATCTTCCTACTCTCGATGGCCTTCACCTCGTTCCTGGACTCCTTGATGGAGTCTCTTTGGGTATT
GAATCTCTAGCAGGTTTTCCGTCACTCAAAACTCTTCCACATACCACTGTCTTGGATTTCCACCGTGTCAACGTA
CATGGTCAGGAATCTAAAAACAAATCGATGGTGGTCAGGATCGAGAATCCTCACGAGGGTTCAAATTCGAACGAA
ATGGCGAACAAGATGGTGGGGGAGAGGATTTTTATGGGATGGCCGTATCTGCAAGAAGGATTGGTTGTGGCGCTA
TCCGACGGGTTGTTCAGCTATGAAAAAGCCGCGCTTGTTGAAGGAGACGCTCCGAAAGTGATATCGAACCCGCAT
CTCCAACACGGTATCAATCACTGGCAAACCAAAGCCGAACGGATCGAGTCGATGTATTCTAAGAAGTACGGAGTG
TTGACAGGAAGAGTTGAAGTTCTATTACATATACGACCGCTGAAGGGGTTGAAGAGGTTGGAGAATGGAGCTTTG
GTTAAGGATTATGAAGATGCGGATAAGGAGATTGAGCAGGCTTTACAGATGTGTTTGAGTGAAGTCGTTTCGGAG
GATCCGAGGTTTTTGGAGAGGGAGCCGCCACCGTTGAATGTTGAGTTCCCTGACGGAAGTAAAGTGTTCTTCCTC
GGAGAACATGCGTATGGCGTGGCAGCTCAGGTGACGGGCACAACGGACACGAGTCTATCGGTTGTTCTTGCGTTC
TTCCCGTCCGAGAAAGCGGAAATGGAAAAGTTCAAAGCTGTTGTCAATAATCGGAGGGCATCGAGATACATTCCT
TCGTTCAGAGCTGCCGAGAGTTTACGAATCTCTCCGCGGGCCTTGTCAAGGATCACCTCGAGTTTCATGGTTGTG
ACAGGTCATGACAAACAAAAGATCAATCTGGGATTGAGTTTGAAATTCGAAGCGAAGTCATTGAAAGTGGTGGAT
TACACGAGGAAGGATGGCAGACATTGGGAATATAGTGAGAAGGCAATGGAGTTGCTTAGGGAGTACAAGGCCGCG
TTTCCTGAGATCTTCAGATGCTTGGATGCGGATAGTGATGCGATGGCTCTCGCATCGGATGTTTTCAGTGAGAGC
AGTAAACCCGACGAGAGGGTTCGAGAGATAAAGGCTTGGCTGAAGCAGAAAGGTGTAACAAACCTTGAACCCGTG
TCCCTCTTCTGTGATCAATTATCCAAGGAAACCGTCGTTGAGCTAGAACAATTAGCCGACTCCTTAACAAAGAGC
AAGTCGCCCTCTGATTTCAAGAAGGCTATTGTGAAGGGAATTCCGAGGCAAGCGGTTCTTAAACCTGCGCATGCC
GTCTATCGGCTCCAGAACCAATGGTTCGGGTTGGGAGATCGAGTAGCCATGGTCAGGGACTCGGGGGCTGTCCCG
TTATCGGTCAAGGGGCTTGTCATAGGGATCAATGCGAACTCGATGGATGTTCTTTGGGATGTACCCTTCATGTCC
GGTGTGACTTTGAGTGACAGATGTTCGCCATATCGCGGCATGACCGTTGAGTTTAATTCATGCCTCAACTTATCG
AATCCGCAGTTTGTCACATCCACAAACCCCAAAGCTCCGCCTCCTCCGCCTATCACCACACCCTTCAATCCGCGC
CACGGACCTTATCCCGCGATTCAACCTGGCCCTGGCCAGCGTGGAGCTTCCGGTTTCCGTCCTGCACTCCAAAGT
CACGCTGGACCGGCAGGACATGTCCAGATCATGAATAATCCTAACCGAGCGAGAGGCAGTCATCATGCGAATGGA
CGCGGTGGGCACCCTGGACACCCGACTATTCCTGCCAACGTAATTGCTGCCCGTGGTCGCGGCGGTGGAGCTGTT
TCAGGATCACAAACCCGTATGAATGGGAGCGGGCGTTCAAGTCAAACACCGACGAGTCCCACTTCTTCTAGTCGC
GTCAATGGATACAGTAACGCGTCGAGCCACATATCCTCGGATCCGGCAGCAGAGACAACGACTCCGTCCAGAGGT
CGTGGCAGAGGGTTCATGCCACGTGGCCGAGGTTTTATTCCGAGCCCGTACCGCGGAGGATCGAGTGGGAGAGGA
AGAGGTCGAGGCTCGTTTACACCAATTCCCTCTTGA
Gene >AgabiH97|087930
ATGGGTATGTCTGCCGGCCTATCCGCCACGGATCGCTGACATTAAACCGTGTTCCTTTGCAGGTATTCCCAAGGT
CAGTCTCCCCCCCAAATAAGCGCACACACCCCCGGGCTCACCCTGCCTTTTTTGCAGTTTTTCCGATACATTTCG
TACGCTTTTGTCTCTCTAAGTTTGGCACCAAATTCTAATTTGAAATTCGAAACAGTGAACGCTACCCTTTGACCT
CCCAGCTAATCCAAGAGAACAAGATTCCGGAATTTGGTCCGTGCCATATCCGCGCCTATTACTCCGGGGCCACTC
ATCACTCTGTCAAACAGATAATCTATACCTTGATTTCAATGGCATCATCCATAACTGTATGGTTTCCGAAAACAT
TTGATCCGTGTTGCTTAGTTCGACCCTAGGTTCTCATCCCAATGACGAAGACGCTCATTTCCGACTTTCTGAAGA
CCAAATATTCACCTCGATCTTTGCCTATGTCGACCATCTCTTCGGCAAAATCAAGCCGAAAAAACTCTTCTTCAT
GGCCGTTGATGGCGTTGCGCCTCGCGCAAAGATGAACCAACAACGGAGCAGGCGTTTCCGGACTGCAAAGGAAGC
GAAAGATGTCAGGGAAAAGGCGGAAAAGAAGGGTGAAAAATTACCTGATGAGAAAGCTTTCGACAGCAACTGTAT
TACCCCTGGTCGGTGTTCCGTTGTCGTCAATGTTTCCTTTGGCTGAAAATCTATGTTCAATCCTAGGCACGCTCT
TCATGGCTCGCTTGTCGGAACAGTTGCGTTATTTTGTAAACAAGAAAATCTCCGAGGATGCCAATTGGCGCGATA
TTGAAGTTGTATTGTCTGGTCACGAAGTACCAGGGGAAGGTGAACACAAAATAATGGAATATATCAGGTTGTCCA
GGGCACAACCAGACTACAATCCCAATATCCGGCATTGTTTATATGGCCTGGATGCCGACCTCATCATGCTGGGAC
TTTTGAGTCATGACCCTCATTTTTGTTTGTTGCGAGAGGAGGTCAAGTTTGGCCCCAAGACGAAGCAGAAGAATA
ACACGAGGCAAAGCCTTCTCCCTTACCTCTTTTTATAAATCATATACTGACTCTCAATCTCTAGTTTGGAGTCGG
TCAACTTTTATCTGCTACATCTATGTTTGATGCGCGAATACCTCGACCTCGAGTTTCGAGATATTGAATCGACGT
TACCGTTTGGGTATAGTTTGGAACGTGTCATTGATGATTTTATTTTGCTTGCCGTTTTCGTTGGGAACGATTTCT
TGCCTAACCTTCCCGACTTACACATTCATGAAAACGGATTGGAGAAGTTGTTTGAAGTGTATAAGAAGGTTTTGC
CTGGTCTTGGTACGTCCTAAACCTCAACAACTGTTGCCACGTGTTTACGTTGTTATTAGAGGGGTATATCAATGA
GGGTGGCGTGATCAACGTCAAGAGGCTTCAAGTCATTCTTGACGAGATGGCACGATGGGAGCAGGATGTTTTTGA
GAAAGAGTACGCCGATTTGAATTGGTTCAAAGGCAAACAAGCAAAACATGTAAAGGAGATGGAAATGGGTCGCAA
GCGGTCTAGTCTTGGTAAGACGCTGTCACAATGTTTTTCCCGCCCCCGGCATTGACACACTTGCCTCATTTCACA
GCATTGACGAAACCTCAAAGAGATATCTTCGCTAAAGTCAAAGGGTATATCCTTGCTAGTCGCAAGGGTCCTTTG
TCTAAAGCGGGAAAGCTTACGATGCTTAATACGTTCCCGGCCAGTGAACGCGCTTTCGTCACTCGGCTTGCGGAA
GAGTTGCATCTCAGTCTACGATTCGATGAGTTTGACGAGAATGATAACAATATTCTTACTTTGACTTTACCGGGT
GTCCAAGAAGACGATGAAGATGGTGGTGTTAGTAAGAATGAAGAAGAGAAGGAGGCGAATGGCACTAGTAGTTCG
GATGCGGAGGTTGTTGAGGAGAGTTCTGGAGGCCCGCCGGATAGCGATTGGGAGGATACGAGTGGCGATGATGAT
GACGCGGATAATGAAGAAAGCCGGATTGCTGTTGATCGAGTGTTGAACAAGTATGACAAGGCGCCGGCTTTTGAC
GATGAAGAGGGTGGCGGTTTTGATGCTCGGCACGAGAGGTCTATTAGGGAAAAGATGGATGAATGGAAAAGAGGT
TATTATCAGGTACATAAAGTTGAACCCAGAATCAAGCTTTTTTTTCGGGCTGACTGGTTTGATGTGTCTAGGGAA
AGATGGAGATTTCATATGACGATCCGAAGGGCATGGGTGATTTGGTGTATAGATATGTCGAGGGGCTGCAGTGGG
TAATGCACTACTATTACAGTGGTGTAGCATCTTGGGGTTGGTTCTACAACTATCATTATGCGCCGCGCATCTCAG
GTACGTGCCGCACTCAGTCCTACAAAAATGCCCAATTGTAAACGGGTTTTACTTCCCTATAGATTTACGCGGCGT
CGACAAGATGACTTTCAACTTTGAGCTCGGTACTCCCTTCAAACCTTTCCAACAGCTGATGGGTGTCCTACCCTC
CGCTAGTATGGAACTCATTCCGGAGCCGTATCGGGAGCTCATGTATGATCCTAATTCACCTATCCTGGATTTCTA
CCCTGTGGAATTCGAGTCGGATCTGAATGGGAAGAAGGCGGAATGGGAGGCAATTGTGAAAATTCCGTTTATTGA
CGAAGTGAGGCTGCTCAAGGCCATGGCTAGTAAGTTCAAGTGGTATTTATTTCGTTGAATTCTTTCTCATTTATG
TTCGTTTGTTGTAGCACGGGAACATCGGTTGACTACGGAAGAGCGCAAACGAAATTCTTGGGGAACAAGTACCAA
ATTTATCTACAATCCTGGCGAAAGCACTGTATATCCCTCGTCTCTTCCCGGATTCTTTCCGACCCTCCAGCGGTG
TCATTGTAGAATGGAGGATTTCGATCTTCCTACTCTCGATGGCCTTCACCTCGTTCCTGGACTCCTTGATGGAGT
CTCTTTGGGTATTGAATCTCTAGCAGGTTTTCCGTCACTCAAAACTCTTCCACATACCACTGTCTTGGATTTCCA
CCGTGTCAACGTACATGGTCAGGAATCTAAAAACAAATCGATGGTGGTCAGGATCGAGAATCCTCACGAGGGTTC
AAATTCGAACGAAATGGCGAACAAGATGGTGGGGGAGAGGATTTTTATGGGATGGCCGTATCTGCAAGAAGGATT
GGTTGTGGCGCTATCCGACGGGTTGTTCAGCTATGAAAAAGCCGCGCTTGTTGAAGGAGACGCTCCGAAAGTGAT
ATCGAACCCGCATCTCCAACACGGTATCAATCACTGGCAAACCAAAGCCGAACGGATCGAGTCGATGTATTCTAA
GAAGTACGGAGTGTTGACAGGAAGAGTTGAAGTTCTATTACATATACGACCGCTGAAGGGGTTGAAGAGGTTGGA
GAATGGAGCTTTGGTTAAGGATTATGAAGATGCGGATAAGGAGATTGAGCAGGCTTTACAGATGTGTTTGAGTGA
AGTCGTTTCGGAGGATCCGAGGTTTTTGGAGAGGGAGCCGCCACCGTTGAATGTTGAGTTCCCTGACGGAAGTAA
AGTGTTCTTCCTCGGAGAACATGCGTATGGCGTGGCAGCTCAGGTGACGGGCACAACGGACACGAGTCTATCGGT
TGTTCTTGCGGTGAGTTTGGTTCTGGCTCCCTTGAAGCTGTTAGAATGCTCGGCTCATTGACGCTGATGTTTTTT
TTTAGTTCTTCCCGTCCGAGAAAGCGGAAATGGAAAAGTTCAAAGCTGTTGTCAATAATCGGAGGGCATCGAGAT
ACATTCCTTCGTTCAGAGCTGCCGAGAGTTTACGAATCTCTCCGCGGGCCTTGTCAAGGATCACCTCGAGTTTCA
TGGTTGTGACAGGTCATGACAAACAAAAGATCAATCTGGGATTGAGTTTGAAATTCGAAGCGAAGTCATTGAAAG
TGGTGGATTACACGAGGAAGGATGGCAGACATTGGGAATATAGTGAGAAGGCAATGGAGTTGCTTAGGGAGTACA
AGGTCCGTTCCATTTCACTTCGATTGTTGCGTGTTCGGACATTGAGATAAGTCGGCTGATTGGGGTGCTTTTTGA
ATTTGTAGGCCGCGTTTCCTGAGATCTTCAGATGCTTGGATGCGGATAGTGATGCGATGGCTCTCGCATCGGATG
TTTTCAGTGAGAGCAGTAAACCCGACGAGAGGGTTCGAGAGATAAAGGCTTGGCTGAAGCAGAAAGGTGTAACAA
ACCTTGAACCCGTGTCCCTCTTCTGTGATCAATTATCCAAGGTATGTGCATGTTCTTTTTCGCTGCTTTCTTCTT
GCCATTACGGGAAGTTGACGGGTTTTGCTCAAATAGGAAACCGTCGTTGAGCTAGAACAATTAGCCGACTCCTTA
ACAAAGAGCAAGTCGCCCTCTGATTTCAAGAAGGCTATTGTGAAGGGAATTCCGAGGCAAGCGGTTCTTAAACCT
GCGCATGCCGTCTATCGGCTCCAGAACCAATGGTTCGGGTTGGGAGATCGAGTAGCCATGGTCAGGGACTCGGGG
GCTGTCCCGTTATCGGTCAAGGGGCTTGTCATAGGGATCAATGCGAACTCGATGGATGTTCTTTGGGATGTACCC
TTCATGTCCGGTGTGACTTTGAGTGACAGGTATGTTGACCTGACTTTCCAAGGCACTGGACGTTGAAACCTCTCA
CTTTCGGACAGATGTTCGCCATATCGCGGCATGACCGTTGAGTTTAATTCATGCCTCAACTTATCGAATCCGCAG
TTTGTCACATCCACAAACCCCAAAGCTCCGCCTCCTCCGCCTATCACCACACCCTTCAATCCGCGCCACGGACCT
TATCCCGCGATTCAACCTGGCCCTGGCCAGCGTGGAGCTTCCGGTTTCCGTCCTGCACTCCAAAGGTAATGAGAA
AAACGCGATTATACCATGTTTAAATCTTTTCTTTAACATATTATGTGATTCTAGTCACGCTGGACCGGCAGGACA
TGTCCAGATCATGAATAATCCTAACCGAGCGAGAGGCAGTCATCATGCGAATGGACGCGGTGGGCACCCTGGACA
CCCGACTATTCCTGCCAACGTAATTGCTGCCCGTGGTCGCGGCGGTGGAGCTGTTTCAGGATCACAAACCCGTAT
GAATGGGAGCGGGCGTTCAAGTCAAACACCGACGAGTCCCACTTCTTCTAGTCGCGTCAATGGATACAGTAACGC
GTCGAGCCACATATCCTCGGATCCGGCAGCAGAGACAACGACTCCGTCCAGAGGTCGTGGCAGAGGGTTCATGCC
ACGTGGCCGAGGTTTTATTCCGAGCCCGTACCGCGGAGGATCGAGTGGGAGAGGAAGAGGTCGAGGCTCGTTTAC
ACCAATTCCCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail