© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|087890 |
| Gene name | |
| Location | scaffold_5:2415990..2416539 |
| Strand | - |
| Gene length (bp) | 549 |
| Transcript length (bp) | 444 |
| Coding sequence length (bp) | 444 |
| Protein length (aa) | 148 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF03501 | S10_plectin | Plectin/S10 domain | 6.9E-43 | 3 | 94 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O14112|RS10A_SCHPO | 40S ribosomal protein S10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1001 PE=3 SV=1 | 1 | 142 | 7.0E-45 |
| sp|O13614|RS10B_SCHPO | 40S ribosomal protein S10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1002 PE=3 SV=1 | 1 | 142 | 9.0E-44 |
| sp|O77302|RS10_LUMRU | 40S ribosomal protein S10 OS=Lumbricus rubellus GN=RPS10 PE=2 SV=1 | 1 | 141 | 1.0E-41 |
| sp|Q962R9|RS10_SPOFR | 40S ribosomal protein S10 OS=Spodoptera frugiperda GN=RpS10 PE=2 SV=1 | 1 | 145 | 3.0E-40 |
| sp|Q08745|RS10A_YEAST | 40S ribosomal protein S10-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10A PE=1 SV=1 | 1 | 99 | 2.0E-39 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O14112|RS10A_SCHPO | 40S ribosomal protein S10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1001 PE=3 SV=1 | 1 | 142 | 7.0E-45 |
| sp|O13614|RS10B_SCHPO | 40S ribosomal protein S10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1002 PE=3 SV=1 | 1 | 142 | 9.0E-44 |
| sp|O77302|RS10_LUMRU | 40S ribosomal protein S10 OS=Lumbricus rubellus GN=RPS10 PE=2 SV=1 | 1 | 141 | 1.0E-41 |
| sp|Q962R9|RS10_SPOFR | 40S ribosomal protein S10 OS=Spodoptera frugiperda GN=RpS10 PE=2 SV=1 | 1 | 145 | 3.0E-40 |
| sp|Q08745|RS10A_YEAST | 40S ribosomal protein S10-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10A PE=1 SV=1 | 1 | 99 | 2.0E-39 |
| sp|P46784|RS10B_YEAST | 40S ribosomal protein S10-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10B PE=1 SV=1 | 1 | 99 | 3.0E-39 |
| sp|P46783|RS10_HUMAN | 40S ribosomal protein S10 OS=Homo sapiens GN=RPS10 PE=1 SV=1 | 1 | 141 | 3.0E-38 |
| sp|Q3T0F4|RS10_BOVIN | 40S ribosomal protein S10 OS=Bos taurus GN=RPS10 PE=2 SV=1 | 1 | 141 | 3.0E-38 |
| sp|P63326|RS10_RAT | 40S ribosomal protein S10 OS=Rattus norvegicus GN=Rps10 PE=2 SV=1 | 1 | 141 | 1.0E-37 |
| sp|P63325|RS10_MOUSE | 40S ribosomal protein S10 OS=Mus musculus GN=Rps10 PE=1 SV=1 | 1 | 141 | 1.0E-37 |
| sp|Q07254|RS10_XENLA | 40S ribosomal protein S10 OS=Xenopus laevis GN=rps10 PE=1 SV=1 | 1 | 130 | 3.0E-37 |
| sp|Q90YR4|RS10_ICTPU | 40S ribosomal protein S10 OS=Ictalurus punctatus GN=rps10 PE=2 SV=1 | 1 | 128 | 2.0E-36 |
| sp|Q9VWG3|RS10B_DROME | 40S ribosomal protein S10b OS=Drosophila melanogaster GN=RpS10b PE=1 SV=2 | 1 | 127 | 8.0E-36 |
| sp|Q9AYP4|RS10_ORYSJ | 40S ribosomal protein S10 OS=Oryza sativa subsp. japonica GN=RPS10 PE=2 SV=2 | 1 | 130 | 1.0E-35 |
| sp|Q9SW09|RS101_ARATH | 40S ribosomal protein S10-1 OS=Arabidopsis thaliana GN=RPS10A PE=2 SV=1 | 1 | 136 | 3.0E-35 |
| sp|Q9NQ39|RS10L_HUMAN | Putative 40S ribosomal protein S10-like OS=Homo sapiens GN=RPS10P5 PE=5 SV=1 | 1 | 141 | 5.0E-34 |
| sp|Q9LTF2|RS103_ARATH | 40S ribosomal protein S10-3 OS=Arabidopsis thaliana GN=RPS10C PE=2 SV=2 | 1 | 122 | 9.0E-34 |
| sp|Q9VB14|RS10A_DROME | 40S ribosomal protein S10a OS=Drosophila melanogaster GN=RpS10a PE=1 SV=1 | 1 | 96 | 6.0E-32 |
| sp|Q9FFS8|RS102_ARATH | 40S ribosomal protein S10-2 OS=Arabidopsis thaliana GN=RPS10B PE=2 SV=1 | 1 | 97 | 7.0E-30 |
| sp|O77082|RS10_DICDI | 40S ribosomal protein S10 OS=Dictyostelium discoideum GN=rps10 PE=1 SV=3 | 2 | 113 | 1.0E-26 |
| sp|Q9QXS1|PLEC_MOUSE | Plectin OS=Mus musculus GN=Plec PE=1 SV=3 | 1 | 145 | 2.0E-23 |
| sp|P30427|PLEC_RAT | Plectin OS=Rattus norvegicus GN=Plec PE=1 SV=2 | 1 | 145 | 2.0E-23 |
| sp|Q15149|PLEC_HUMAN | Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 | 1 | 98 | 7.0E-22 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 1528.27 | 853.45 | 2203.08 |
| Initials | Initials knots | 781.09 | 462.20 | 1099.99 |
| Pileal_Stipeal_center | Stage I stipe center | 781.39 | 455.99 | 1106.79 |
| Pileal_Stipeal_shell | Stage I stipe shell | 741.04 | 439.47 | 1042.61 |
| DIF_stipe_center | Stage II stipe center | 697.43 | 414.89 | 979.96 |
| DIF_stipe_shell | Stage II stipe shell | 579.01 | 344.57 | 813.46 |
| DIF_stipe_skin | Stage II stipe skin | 697.82 | 414.26 | 981.39 |
| DIF_cap_skin | Stage II cap skin | 552.80 | 331.24 | 774.36 |
| DIF_cap_tissue | Stage II cap tissue | 689.66 | 407.90 | 971.42 |
| DIF_gill_tissue | Stage II gill tissue | 893.85 | 521.13 | 1266.57 |
| YFB_stipe_center | Young fruiting body stipe center | 625.99 | 370.81 | 881.18 |
| YFB_stipe_shell | Young fruiting body stipe shell | 452.18 | 269.18 | 635.17 |
| YFB_stipe_skin | Young fruiting body stipe skin | 546.97 | 320.27 | 773.68 |
| YFB_cap_skin | Young fruiting body cap skin | 293.44 | 174.01 | 412.87 |
| YFB_cap_tissue | Young fruiting body cap tissue | 177.51 | 102.20 | 252.81 |
| YFB_gill_tissue | Young fruiting body gill tissue | 385.21 | 224.26 | 546.17 |
| YFB_veil | Young fruiting body veil | 530.63 | 314.72 | 746.54 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.065833 | no |
| Casing | YFB_stipe_center | 0.001140 | yes |
| Casing | YFB_stipe_shell | 0.000613 | yes |
| Casing | YFB_stipe_skin | 0.000613 | yes |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.000613 | yes |
| Casing | YFB_veil | 0.000613 | yes |
| Casing | Initials | 0.014374 | yes |
| Casing | Pileal_Stipeal_center | 0.010728 | yes |
| Casing | Pileal_Stipeal_shell | 0.006032 | yes |
| Casing | DIF_stipe_center | 0.003365 | yes |
| Casing | DIF_stipe_shell | 0.000613 | yes |
| Casing | DIF_stipe_skin | 0.002951 | yes |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.002525 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.244805 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.007782 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.083843 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_veil | 0.057550 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.299835 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.754805 | no |
| YFB_stipe_center | YFB_cap_skin | 0.002084 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.074130 | no |
| YFB_stipe_center | YFB_veil | 0.679894 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.620893 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.128525 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.687290 | no |
| YFB_stipe_shell | YFB_veil | 0.692408 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.023415 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.259790 | no |
| YFB_stipe_skin | YFB_veil | 0.956475 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.085387 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.417115 | no |
| YFB_cap_skin | YFB_veil | 0.025205 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 0.003365 | yes |
| YFB_cap_tissue | YFB_veil | 0.000613 | yes |
| YFB_gill_tissue | YFB_veil | 0.304968 | no |
| Initials | DIF_gill_tissue | 0.752354 | no |
| Initials | YFB_stipe_center | 0.529277 | no |
| Initials | YFB_stipe_shell | 0.041164 | yes |
| Initials | YFB_stipe_skin | 0.242440 | no |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.005302 | yes |
| Initials | YFB_veil | 0.189390 | no |
| Initials | Pileal_Stipeal_center | 0.999109 | no |
| Initials | Pileal_Stipeal_shell | 0.919172 | no |
| Initials | DIF_stipe_center | 0.795566 | no |
| Initials | DIF_stipe_shell | 0.346962 | no |
| Initials | DIF_stipe_skin | 0.799621 | no |
| Initials | DIF_cap_skin | 0.250159 | no |
| Initials | DIF_cap_tissue | 0.773355 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.755490 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.534503 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.040279 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.251757 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.006032 | yes |
| Pileal_Stipeal_center | YFB_veil | 0.194842 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.918987 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.795974 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.356879 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.800002 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.258617 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.774669 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.626833 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.661676 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.069197 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.353184 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.011041 | yes |
| Pileal_Stipeal_shell | YFB_veil | 0.280565 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.904015 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.476094 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.907075 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.362726 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.885478 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.485415 | no |
| DIF_stipe_center | YFB_stipe_center | 0.812524 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.134864 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.500419 | no |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.021322 | yes |
| DIF_stipe_center | YFB_veil | 0.416361 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.637596 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.998720 | no |
| DIF_stipe_center | DIF_cap_skin | 0.512411 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.984672 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.130393 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.875427 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.475834 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.917243 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.008457 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.159322 | no |
| DIF_stipe_shell | YFB_veil | 0.859199 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.628638 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.930382 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.660228 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.485804 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.809616 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.125142 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.497996 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.021056 | yes |
| DIF_stipe_skin | YFB_veil | 0.414928 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.508322 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.983610 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.079479 | no |
| DIF_cap_skin | YFB_stipe_center | 0.767826 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.583417 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.984710 | no |
| DIF_cap_skin | YFB_cap_skin | 0.014374 | yes |
| DIF_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_gill_tissue | 0.218856 | no |
| DIF_cap_skin | YFB_veil | 0.939167 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.527932 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.446922 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.833865 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.139707 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.517741 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.001140 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_gill_tissue | 0.022369 | yes |
| DIF_cap_tissue | YFB_veil | 0.433300 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|087890 MLISKQNRRIIYENLFKEGVLVAKKDFNAPKHEDLDVPNLEVIKALQSLTSRGLVKMQFSWQWYYYVLTPEGVEY LREWLHLPAEIVPATYKKAARPTRPAGIRSGGEGAYRPPRGDRDDYRKKEGAPEGFSQKTQYAGVGRGGPRE* |
| Coding | >AgabiH97|087890 ATGCTGATCTCAAAACAGAACAGGCGCATCATCTACGAAAACCTTTTCAAGGAGGGTGTCCTTGTAGCAAAGAAA GATTTCAACGCGCCCAAACACGAAGATCTCGATGTTCCTAACCTTGAGGTGATCAAGGCCCTGCAAAGCCTTACC TCCAGGGGTCTGGTCAAGATGCAATTCTCATGGCAATGGTACTATTATGTATTGACTCCTGAAGGTGTCGAATAC CTCCGTGAATGGCTTCACCTACCGGCAGAAATTGTTCCCGCCACTTACAAAAAGGCGGCTCGCCCAACTCGCCCA GCAGGCATCCGTTCTGGAGGTGAGGGTGCCTACCGCCCACCTCGTGGTGACCGGGATGACTACCGTAAGAAGGAG GGTGCCCCTGAAGGTTTCAGCCAGAAGACACAGTATGCTGGTGTTGGTCGGGGCGGACCTAGGGAGTAA |
| Transcript | >AgabiH97|087890 ATGCTGATCTCAAAACAGAACAGGCGCATCATCTACGAAAACCTTTTCAAGGAGGGTGTCCTTGTAGCAAAGAAA GATTTCAACGCGCCCAAACACGAAGATCTCGATGTTCCTAACCTTGAGGTGATCAAGGCCCTGCAAAGCCTTACC TCCAGGGGTCTGGTCAAGATGCAATTCTCATGGCAATGGTACTATTATGTATTGACTCCTGAAGGTGTCGAATAC CTCCGTGAATGGCTTCACCTACCGGCAGAAATTGTTCCCGCCACTTACAAAAAGGCGGCTCGCCCAACTCGCCCA GCAGGCATCCGTTCTGGAGGTGAGGGTGCCTACCGCCCACCTCGTGGTGACCGGGATGACTACCGTAAGAAGGAG GGTGCCCCTGAAGGTTTCAGCCAGAAGACACAGTATGCTGGTGTTGGTCGGGGCGGACCTAGGGAGTAA |
| Gene | >AgabiH97|087890 ATGCTGATCTCAAAACAGAACAGGCGCATCATCTACGAAAACCTTTTCAAGGGTGCGTTTCCTTAAACGAAATGC CGCTCTTTTCGTTAATTCAAGTCTGTCACAGAGGGTGTCCTTGTAGCAAAGAAAGATTTCAACGCGCCCAAACAC GAAGATCTCGATGTTCCTAACCTTGAGGTGATCAAGGCCCTGCAAAGCCTTACCTCCAGGGGTCTGGTCAAGATG CAATTCTCATGGCAATGGTACTATTATGTATTGACTCCTGAAGGTGTCGAATACCTCCGTGAATGGTGCGTGACT AACGAAATTATGCGACGATCATGGTCCTCATTCATTGAAAGGCTTCACCTACCGGCAGAAATTGTTCCCGCCACT TACAAAAAGGCGGCTCGCCCAACTCGCCCAGCAGGCATCCGTTCTGGAGGTGAGGGTGCCTACCGCCCACCTCGT GGTGACCGGGATGACTACCGTAAGAAGGAGGGTGCCCCTGAAGGTTTCAGCCAGAAGACACAGTATGCTGGTGTT GGTCGGGGCGGACCTAGGGAGTAA |