Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|087890
Gene name
Locationscaffold_5:2415990..2416539
Strand-
Gene length (bp)549
Transcript length (bp)444
Coding sequence length (bp)444
Protein length (aa) 148

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03501 S10_plectin Plectin/S10 domain 6.9E-43 3 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14112|RS10A_SCHPO 40S ribosomal protein S10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1001 PE=3 SV=1 1 142 7.0E-45
sp|O13614|RS10B_SCHPO 40S ribosomal protein S10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1002 PE=3 SV=1 1 142 9.0E-44
sp|O77302|RS10_LUMRU 40S ribosomal protein S10 OS=Lumbricus rubellus GN=RPS10 PE=2 SV=1 1 141 1.0E-41
sp|Q962R9|RS10_SPOFR 40S ribosomal protein S10 OS=Spodoptera frugiperda GN=RpS10 PE=2 SV=1 1 145 3.0E-40
sp|Q08745|RS10A_YEAST 40S ribosomal protein S10-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10A PE=1 SV=1 1 99 2.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14112|RS10A_SCHPO 40S ribosomal protein S10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1001 PE=3 SV=1 1 142 7.0E-45
sp|O13614|RS10B_SCHPO 40S ribosomal protein S10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1002 PE=3 SV=1 1 142 9.0E-44
sp|O77302|RS10_LUMRU 40S ribosomal protein S10 OS=Lumbricus rubellus GN=RPS10 PE=2 SV=1 1 141 1.0E-41
sp|Q962R9|RS10_SPOFR 40S ribosomal protein S10 OS=Spodoptera frugiperda GN=RpS10 PE=2 SV=1 1 145 3.0E-40
sp|Q08745|RS10A_YEAST 40S ribosomal protein S10-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10A PE=1 SV=1 1 99 2.0E-39
sp|P46784|RS10B_YEAST 40S ribosomal protein S10-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10B PE=1 SV=1 1 99 3.0E-39
sp|P46783|RS10_HUMAN 40S ribosomal protein S10 OS=Homo sapiens GN=RPS10 PE=1 SV=1 1 141 3.0E-38
sp|Q3T0F4|RS10_BOVIN 40S ribosomal protein S10 OS=Bos taurus GN=RPS10 PE=2 SV=1 1 141 3.0E-38
sp|P63326|RS10_RAT 40S ribosomal protein S10 OS=Rattus norvegicus GN=Rps10 PE=2 SV=1 1 141 1.0E-37
sp|P63325|RS10_MOUSE 40S ribosomal protein S10 OS=Mus musculus GN=Rps10 PE=1 SV=1 1 141 1.0E-37
sp|Q07254|RS10_XENLA 40S ribosomal protein S10 OS=Xenopus laevis GN=rps10 PE=1 SV=1 1 130 3.0E-37
sp|Q90YR4|RS10_ICTPU 40S ribosomal protein S10 OS=Ictalurus punctatus GN=rps10 PE=2 SV=1 1 128 2.0E-36
sp|Q9VWG3|RS10B_DROME 40S ribosomal protein S10b OS=Drosophila melanogaster GN=RpS10b PE=1 SV=2 1 127 8.0E-36
sp|Q9AYP4|RS10_ORYSJ 40S ribosomal protein S10 OS=Oryza sativa subsp. japonica GN=RPS10 PE=2 SV=2 1 130 1.0E-35
sp|Q9SW09|RS101_ARATH 40S ribosomal protein S10-1 OS=Arabidopsis thaliana GN=RPS10A PE=2 SV=1 1 136 3.0E-35
sp|Q9NQ39|RS10L_HUMAN Putative 40S ribosomal protein S10-like OS=Homo sapiens GN=RPS10P5 PE=5 SV=1 1 141 5.0E-34
sp|Q9LTF2|RS103_ARATH 40S ribosomal protein S10-3 OS=Arabidopsis thaliana GN=RPS10C PE=2 SV=2 1 122 9.0E-34
sp|Q9VB14|RS10A_DROME 40S ribosomal protein S10a OS=Drosophila melanogaster GN=RpS10a PE=1 SV=1 1 96 6.0E-32
sp|Q9FFS8|RS102_ARATH 40S ribosomal protein S10-2 OS=Arabidopsis thaliana GN=RPS10B PE=2 SV=1 1 97 7.0E-30
sp|O77082|RS10_DICDI 40S ribosomal protein S10 OS=Dictyostelium discoideum GN=rps10 PE=1 SV=3 2 113 1.0E-26
sp|Q9QXS1|PLEC_MOUSE Plectin OS=Mus musculus GN=Plec PE=1 SV=3 1 145 2.0E-23
sp|P30427|PLEC_RAT Plectin OS=Rattus norvegicus GN=Plec PE=1 SV=2 1 145 2.0E-23
sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 1 98 7.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|087890
MLISKQNRRIIYENLFKEGVLVAKKDFNAPKHEDLDVPNLEVIKALQSLTSRGLVKMQFSWQWYYYVLTPEGVEY
LREWLHLPAEIVPATYKKAARPTRPAGIRSGGEGAYRPPRGDRDDYRKKEGAPEGFSQKTQYAGVGRGGPRE*
Coding >AgabiH97|087890
ATGCTGATCTCAAAACAGAACAGGCGCATCATCTACGAAAACCTTTTCAAGGAGGGTGTCCTTGTAGCAAAGAAA
GATTTCAACGCGCCCAAACACGAAGATCTCGATGTTCCTAACCTTGAGGTGATCAAGGCCCTGCAAAGCCTTACC
TCCAGGGGTCTGGTCAAGATGCAATTCTCATGGCAATGGTACTATTATGTATTGACTCCTGAAGGTGTCGAATAC
CTCCGTGAATGGCTTCACCTACCGGCAGAAATTGTTCCCGCCACTTACAAAAAGGCGGCTCGCCCAACTCGCCCA
GCAGGCATCCGTTCTGGAGGTGAGGGTGCCTACCGCCCACCTCGTGGTGACCGGGATGACTACCGTAAGAAGGAG
GGTGCCCCTGAAGGTTTCAGCCAGAAGACACAGTATGCTGGTGTTGGTCGGGGCGGACCTAGGGAGTAA
Transcript >AgabiH97|087890
ATGCTGATCTCAAAACAGAACAGGCGCATCATCTACGAAAACCTTTTCAAGGAGGGTGTCCTTGTAGCAAAGAAA
GATTTCAACGCGCCCAAACACGAAGATCTCGATGTTCCTAACCTTGAGGTGATCAAGGCCCTGCAAAGCCTTACC
TCCAGGGGTCTGGTCAAGATGCAATTCTCATGGCAATGGTACTATTATGTATTGACTCCTGAAGGTGTCGAATAC
CTCCGTGAATGGCTTCACCTACCGGCAGAAATTGTTCCCGCCACTTACAAAAAGGCGGCTCGCCCAACTCGCCCA
GCAGGCATCCGTTCTGGAGGTGAGGGTGCCTACCGCCCACCTCGTGGTGACCGGGATGACTACCGTAAGAAGGAG
GGTGCCCCTGAAGGTTTCAGCCAGAAGACACAGTATGCTGGTGTTGGTCGGGGCGGACCTAGGGAGTAA
Gene >AgabiH97|087890
ATGCTGATCTCAAAACAGAACAGGCGCATCATCTACGAAAACCTTTTCAAGGGTGCGTTTCCTTAAACGAAATGC
CGCTCTTTTCGTTAATTCAAGTCTGTCACAGAGGGTGTCCTTGTAGCAAAGAAAGATTTCAACGCGCCCAAACAC
GAAGATCTCGATGTTCCTAACCTTGAGGTGATCAAGGCCCTGCAAAGCCTTACCTCCAGGGGTCTGGTCAAGATG
CAATTCTCATGGCAATGGTACTATTATGTATTGACTCCTGAAGGTGTCGAATACCTCCGTGAATGGTGCGTGACT
AACGAAATTATGCGACGATCATGGTCCTCATTCATTGAAAGGCTTCACCTACCGGCAGAAATTGTTCCCGCCACT
TACAAAAAGGCGGCTCGCCCAACTCGCCCAGCAGGCATCCGTTCTGGAGGTGAGGGTGCCTACCGCCCACCTCGT
GGTGACCGGGATGACTACCGTAAGAAGGAGGGTGCCCCTGAAGGTTTCAGCCAGAAGACACAGTATGCTGGTGTT
GGTCGGGGCGGACCTAGGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail