Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|087830
Gene name
Locationscaffold_5:2389067..2393019
Strand+
Gene length (bp)3952
Transcript length (bp)3711
Coding sequence length (bp)3711
Protein length (aa) 1237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11702 DUF3295 Protein of unknown function (DUF3295) 1.5E-14 1142 1236
PF08550 DUF1752 Fungal protein of unknown function (DUF1752) 3.4E-10 28 55

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTM5|YIJ1_SCHPO Uncharacterized protein C1420.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1420.01c PE=4 SV=2 23 55 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|087830
MDSFPTPVLAAAADVIKHVDGDDSLPILWTFFTKFKESLQDGHRLENISWRLWYQSMVAANFPLSSDLLEPPPDA
YPFFLNETPYRPLTPDELPRRAFTTDCSPLSSHGIINPLHTPPLDEQSTGSSSVASSLPNYFSHKPFSSTRRNSF
RKASSPVNVGKILCELFPSAPVPSLMSLGSGFSNGPTLPVESPPTQYGNLRALSSVSLPLSSPLSHFVANIRHTI
TSATENVGPPQSLPTPEAEEGDSSLGPSLSKGLGRTEPPAILPVIMADNSSPANRRDELLSTAHEHPPSLPLPPL
LVVVKPTPDPTPHPTPPATPVQRHSIVGQEEDADAVSSVPRLNIPGRGQHALIQAQTRGSRCSQSQSTAQLVIAD
GDGNPLASGTNLASARNYDPTEKLPMILALPASANSERAAHLVSNLQSISLDTTSSSSQRSSFTPSEFSKATTAT
TISEPYHCTHHIEKRSLSFVSSPSLDQVTAGSDTGLLPTSPLYESEMESSAPKRRKEKATSLGSTTGKLSGSSTS
KAPGSLTSNKGASPSFRPTNTARKLGNNKGGNEAGASTATGRSRTSKSRSRSRTRESGNAALHALVMTRAAASGR
GAAGKAAIRTRSGGGVRRGKSGVAKKVNMNEVVREGVVMFNFGSTSEEGSKSTGTGSGSEVIGRRERVESGQNDE
GVAKMMEDSSSHKGTDVDVPAPPPVEEKAAVVSTDKEKGKGKEKAKSGVTTTIEATIADPLLPGSVRRQIVLTSD
DDSEGFETETDSWSDTESADAPTTTSQQRLPTEMEQSQVPQQPQQQQQQQQQQRQQQRQQHRPTPSRTHSDHFPR
NNRPVTRAYQRLAEQRAAEDRRWKEEMFVKLPKASFENLAKINRTRSGGLLSQLLKPEIQPLSTDPTYRRGFSSG
VIQPLRPFTPVAQQQPQPQPQQQVQPQQQQQTQTQQQQQTQHIGHKPPSPVPDTQAITTQQISSSQPPPPMVVGD
ARPSQHSRQPSRTYQLPKRLAALTKPSIVASKTPVASAVMSELRVGSINGVKQVTTGGVSVNGSAGKYKPKGRPP
ETVMEYSSDSETDDNQLDLSKSVAQEKLRALLEAKKLKKSAQGADSSFLTDEGQNKSDLSGGRQASSQPVEPISI
PPPRLLYPYNLPPPNPPTTPRTTRRKMLAVEIPESLRRNLLWERQVSQAHARGLGRRRSMNDVKGWHIPNLVKLT
PKGAKQDEPNDVQKERDRRYLARTRSWAFQYHAVGW*
Coding >AgabiH97|087830
ATGGATTCGTTTCCTACGCCGGTCTTAGCCGCGGCTGCAGACGTCATAAAGCACGTCGACGGTGACGACTCACTC
CCCATCCTCTGGACCTTCTTCACCAAGTTCAAGGAGTCGCTTCAGGACGGCCACAGACTCGAGAACATATCCTGG
CGCCTTTGGTATCAGTCCATGGTTGCCGCAAATTTTCCTCTCTCTAGTGACCTTTTGGAACCCCCTCCGGATGCA
TACCCCTTCTTTCTCAACGAGACACCATATCGGCCGCTCACCCCCGACGAACTGCCTCGCCGTGCCTTCACTACT
GATTGCTCGCCGTTGTCTTCGCATGGTATAATAAATCCCCTACACACACCGCCTCTCGATGAGCAAAGCACCGGC
TCGTCATCAGTCGCATCGTCCCTCCCGAACTACTTTTCTCATAAGCCATTTTCTTCCACTCGGAGGAATAGCTTT
AGGAAAGCATCGTCTCCTGTAAACGTGGGCAAAATTCTTTGCGAACTATTCCCTTCTGCCCCCGTTCCCTCTTTG
ATGTCCCTAGGCTCCGGTTTCAGTAATGGACCAACCCTGCCGGTGGAATCGCCCCCAACGCAATATGGTAATCTG
CGAGCGTTATCTTCAGTGTCCCTCCCTTTATCCAGTCCCTTATCCCACTTTGTTGCCAACATTCGACATACCATC
ACGTCGGCAACAGAGAACGTTGGCCCACCACAGTCATTGCCTACGCCTGAAGCTGAAGAAGGTGACTCCTCTTTG
GGCCCAAGCTTATCGAAAGGCCTTGGCAGAACCGAGCCTCCTGCCATATTACCGGTAATCATGGCCGATAACTCG
TCTCCTGCCAACAGACGCGATGAGCTGTTATCTACTGCACATGAACACCCTCCAAGTTTGCCACTACCTCCCTTA
TTAGTCGTCGTCAAACCGACACCAGACCCCACTCCTCATCCCACTCCCCCGGCGACGCCAGTGCAACGTCATTCT
ATTGTTGGCCAGGAGGAAGACGCGGACGCGGTGTCTTCGGTTCCGCGATTGAACATTCCAGGCCGTGGTCAGCAT
GCACTAATTCAGGCGCAGACACGTGGGAGCAGATGCTCCCAATCACAGTCAACAGCGCAATTGGTTATAGCTGAC
GGAGATGGAAATCCACTTGCTTCTGGTACGAACTTAGCAAGTGCTCGGAATTACGACCCGACCGAAAAGCTACCC
ATGATCCTCGCATTGCCTGCTTCGGCCAATTCGGAACGTGCTGCCCACCTAGTCTCGAATCTTCAATCTATTTCC
TTGGATACTACAAGCTCCAGCTCGCAGCGCTCATCATTTACGCCATCGGAGTTTAGTAAAGCTACGACTGCTACC
ACGATATCTGAGCCATACCACTGCACCCATCATATTGAAAAACGCTCTTTGTCATTCGTATCTTCACCTTCGCTT
GATCAAGTTACCGCTGGTTCGGATACCGGTTTATTGCCGACATCTCCGCTTTATGAATCGGAAATGGAATCATCT
GCACCTAAGAGGCGTAAAGAGAAGGCTACTAGCTTGGGGTCTACAACTGGGAAGCTGTCAGGTTCTTCGACTTCG
AAAGCTCCTGGTTCCTTAACGTCAAATAAAGGAGCCTCTCCATCGTTTCGTCCAACGAACACAGCACGCAAACTG
GGTAACAACAAAGGTGGCAATGAAGCAGGTGCAAGTACTGCTACCGGTCGTAGTCGAACATCAAAAAGTCGGAGT
AGAAGTAGGACGAGGGAGAGTGGAAATGCGGCGTTGCATGCTTTGGTGATGACGAGAGCTGCTGCTTCTGGGCGA
GGTGCTGCTGGGAAGGCAGCGATCAGGACGCGGAGTGGTGGAGGTGTGCGACGTGGTAAAAGTGGTGTTGCGAAG
AAGGTGAATATGAATGAAGTGGTGAGGGAGGGGGTTGTTATGTTCAATTTTGGTTCAACTTCAGAAGAGGGATCG
AAAAGTACTGGAACTGGAAGTGGATCAGAAGTGATCGGGAGGCGCGAACGAGTGGAATCGGGTCAGAACGACGAG
GGAGTGGCGAAAATGATGGAGGATTCGTCGTCACATAAAGGCACAGATGTTGATGTGCCTGCGCCTCCGCCGGTT
GAGGAGAAGGCGGCGGTAGTGTCAACGGATAAAGAGAAGGGCAAGGGTAAAGAGAAGGCGAAGTCTGGGGTTACT
ACAACTATCGAAGCCACCATTGCCGACCCATTGCTACCAGGCTCTGTTCGTCGGCAGATTGTGCTTACAAGTGAC
GACGATTCGGAGGGTTTCGAGACGGAAACGGATTCTTGGTCTGATACCGAAAGTGCTGATGCGCCTACGACCACT
TCTCAACAACGGTTACCCACGGAAATGGAACAATCACAAGTACCTCAGCAGCCGCAACAACAACAACAACAACAA
CAACAACAGCGACAACAGCAACGCCAGCAACATCGTCCTACCCCTTCCCGTACTCACTCCGATCACTTCCCTCGC
AATAATCGACCTGTCACTCGTGCTTATCAAAGATTAGCTGAACAACGCGCGGCCGAGGACCGTAGGTGGAAGGAA
GAAATGTTTGTCAAACTCCCGAAGGCATCGTTTGAGAACCTGGCGAAGATTAATAGGACCCGGAGTGGAGGATTA
CTGTCGCAGTTGCTGAAACCTGAAATTCAACCATTATCGACGGATCCTACTTATCGAAGAGGATTCAGTTCTGGG
GTTATTCAACCTCTTCGGCCGTTTACTCCCGTAGCGCAGCAGCAGCCACAGCCACAGCCACAGCAGCAGGTACAA
CCACAACAGCAGCAACAGACACAGACACAGCAACAGCAACAGACACAACACATCGGTCATAAACCTCCGTCTCCA
GTTCCTGATACACAAGCTATTACCACCCAACAAATATCCTCCTCTCAACCCCCACCGCCCATGGTTGTCGGCGAT
GCTCGACCTAGTCAGCATAGTCGACAACCTAGTCGGACGTATCAGCTTCCTAAACGCTTAGCTGCTTTGACCAAG
CCCTCCATCGTTGCTTCAAAGACACCGGTGGCATCAGCGGTGATGTCGGAGCTCCGCGTTGGTAGTATTAACGGA
GTCAAACAAGTGACGACGGGTGGCGTTAGTGTCAATGGGAGTGCTGGGAAGTATAAGCCGAAGGGTCGACCCCCG
GAGACCGTGATGGAGTATAGCAGTGATAGCGAGACTGATGATAACCAATTGGACTTGTCGAAGAGTGTTGCACAG
GAAAAGTTGAGGGCGCTGTTGGAGGCGAAGAAATTGAAAAAATCGGCACAGGGAGCCGATTCGAGTTTTCTTACC
GATGAAGGTCAGAATAAGAGCGATTTAAGCGGCGGACGACAGGCTTCTAGTCAGCCTGTGGAACCTATATCGATA
CCCCCTCCACGTTTATTGTATCCTTACAATTTACCACCTCCCAACCCACCCACGACCCCGCGTACGACGAGAAGG
AAGATGTTGGCGGTTGAGATTCCGGAGAGTTTGAGGAGGAATTTGTTGTGGGAGAGACAGGTTAGTCAAGCGCAT
GCTAGGGGTCTTGGGAGACGACGTAGTATGAACGACGTGAAGGGTTGGCATATACCCAATCTTGTGAAGTTGACA
CCGAAAGGAGCGAAGCAGGATGAGCCGAATGATGTCCAGAAGGAGAGAGATAGGAGGTATCTTGCGAGAACGAGG
AGTTGGGCTTTCCAGTATCATGCTGTCGGATGGTGA
Transcript >AgabiH97|087830
ATGGATTCGTTTCCTACGCCGGTCTTAGCCGCGGCTGCAGACGTCATAAAGCACGTCGACGGTGACGACTCACTC
CCCATCCTCTGGACCTTCTTCACCAAGTTCAAGGAGTCGCTTCAGGACGGCCACAGACTCGAGAACATATCCTGG
CGCCTTTGGTATCAGTCCATGGTTGCCGCAAATTTTCCTCTCTCTAGTGACCTTTTGGAACCCCCTCCGGATGCA
TACCCCTTCTTTCTCAACGAGACACCATATCGGCCGCTCACCCCCGACGAACTGCCTCGCCGTGCCTTCACTACT
GATTGCTCGCCGTTGTCTTCGCATGGTATAATAAATCCCCTACACACACCGCCTCTCGATGAGCAAAGCACCGGC
TCGTCATCAGTCGCATCGTCCCTCCCGAACTACTTTTCTCATAAGCCATTTTCTTCCACTCGGAGGAATAGCTTT
AGGAAAGCATCGTCTCCTGTAAACGTGGGCAAAATTCTTTGCGAACTATTCCCTTCTGCCCCCGTTCCCTCTTTG
ATGTCCCTAGGCTCCGGTTTCAGTAATGGACCAACCCTGCCGGTGGAATCGCCCCCAACGCAATATGGTAATCTG
CGAGCGTTATCTTCAGTGTCCCTCCCTTTATCCAGTCCCTTATCCCACTTTGTTGCCAACATTCGACATACCATC
ACGTCGGCAACAGAGAACGTTGGCCCACCACAGTCATTGCCTACGCCTGAAGCTGAAGAAGGTGACTCCTCTTTG
GGCCCAAGCTTATCGAAAGGCCTTGGCAGAACCGAGCCTCCTGCCATATTACCGGTAATCATGGCCGATAACTCG
TCTCCTGCCAACAGACGCGATGAGCTGTTATCTACTGCACATGAACACCCTCCAAGTTTGCCACTACCTCCCTTA
TTAGTCGTCGTCAAACCGACACCAGACCCCACTCCTCATCCCACTCCCCCGGCGACGCCAGTGCAACGTCATTCT
ATTGTTGGCCAGGAGGAAGACGCGGACGCGGTGTCTTCGGTTCCGCGATTGAACATTCCAGGCCGTGGTCAGCAT
GCACTAATTCAGGCGCAGACACGTGGGAGCAGATGCTCCCAATCACAGTCAACAGCGCAATTGGTTATAGCTGAC
GGAGATGGAAATCCACTTGCTTCTGGTACGAACTTAGCAAGTGCTCGGAATTACGACCCGACCGAAAAGCTACCC
ATGATCCTCGCATTGCCTGCTTCGGCCAATTCGGAACGTGCTGCCCACCTAGTCTCGAATCTTCAATCTATTTCC
TTGGATACTACAAGCTCCAGCTCGCAGCGCTCATCATTTACGCCATCGGAGTTTAGTAAAGCTACGACTGCTACC
ACGATATCTGAGCCATACCACTGCACCCATCATATTGAAAAACGCTCTTTGTCATTCGTATCTTCACCTTCGCTT
GATCAAGTTACCGCTGGTTCGGATACCGGTTTATTGCCGACATCTCCGCTTTATGAATCGGAAATGGAATCATCT
GCACCTAAGAGGCGTAAAGAGAAGGCTACTAGCTTGGGGTCTACAACTGGGAAGCTGTCAGGTTCTTCGACTTCG
AAAGCTCCTGGTTCCTTAACGTCAAATAAAGGAGCCTCTCCATCGTTTCGTCCAACGAACACAGCACGCAAACTG
GGTAACAACAAAGGTGGCAATGAAGCAGGTGCAAGTACTGCTACCGGTCGTAGTCGAACATCAAAAAGTCGGAGT
AGAAGTAGGACGAGGGAGAGTGGAAATGCGGCGTTGCATGCTTTGGTGATGACGAGAGCTGCTGCTTCTGGGCGA
GGTGCTGCTGGGAAGGCAGCGATCAGGACGCGGAGTGGTGGAGGTGTGCGACGTGGTAAAAGTGGTGTTGCGAAG
AAGGTGAATATGAATGAAGTGGTGAGGGAGGGGGTTGTTATGTTCAATTTTGGTTCAACTTCAGAAGAGGGATCG
AAAAGTACTGGAACTGGAAGTGGATCAGAAGTGATCGGGAGGCGCGAACGAGTGGAATCGGGTCAGAACGACGAG
GGAGTGGCGAAAATGATGGAGGATTCGTCGTCACATAAAGGCACAGATGTTGATGTGCCTGCGCCTCCGCCGGTT
GAGGAGAAGGCGGCGGTAGTGTCAACGGATAAAGAGAAGGGCAAGGGTAAAGAGAAGGCGAAGTCTGGGGTTACT
ACAACTATCGAAGCCACCATTGCCGACCCATTGCTACCAGGCTCTGTTCGTCGGCAGATTGTGCTTACAAGTGAC
GACGATTCGGAGGGTTTCGAGACGGAAACGGATTCTTGGTCTGATACCGAAAGTGCTGATGCGCCTACGACCACT
TCTCAACAACGGTTACCCACGGAAATGGAACAATCACAAGTACCTCAGCAGCCGCAACAACAACAACAACAACAA
CAACAACAGCGACAACAGCAACGCCAGCAACATCGTCCTACCCCTTCCCGTACTCACTCCGATCACTTCCCTCGC
AATAATCGACCTGTCACTCGTGCTTATCAAAGATTAGCTGAACAACGCGCGGCCGAGGACCGTAGGTGGAAGGAA
GAAATGTTTGTCAAACTCCCGAAGGCATCGTTTGAGAACCTGGCGAAGATTAATAGGACCCGGAGTGGAGGATTA
CTGTCGCAGTTGCTGAAACCTGAAATTCAACCATTATCGACGGATCCTACTTATCGAAGAGGATTCAGTTCTGGG
GTTATTCAACCTCTTCGGCCGTTTACTCCCGTAGCGCAGCAGCAGCCACAGCCACAGCCACAGCAGCAGGTACAA
CCACAACAGCAGCAACAGACACAGACACAGCAACAGCAACAGACACAACACATCGGTCATAAACCTCCGTCTCCA
GTTCCTGATACACAAGCTATTACCACCCAACAAATATCCTCCTCTCAACCCCCACCGCCCATGGTTGTCGGCGAT
GCTCGACCTAGTCAGCATAGTCGACAACCTAGTCGGACGTATCAGCTTCCTAAACGCTTAGCTGCTTTGACCAAG
CCCTCCATCGTTGCTTCAAAGACACCGGTGGCATCAGCGGTGATGTCGGAGCTCCGCGTTGGTAGTATTAACGGA
GTCAAACAAGTGACGACGGGTGGCGTTAGTGTCAATGGGAGTGCTGGGAAGTATAAGCCGAAGGGTCGACCCCCG
GAGACCGTGATGGAGTATAGCAGTGATAGCGAGACTGATGATAACCAATTGGACTTGTCGAAGAGTGTTGCACAG
GAAAAGTTGAGGGCGCTGTTGGAGGCGAAGAAATTGAAAAAATCGGCACAGGGAGCCGATTCGAGTTTTCTTACC
GATGAAGGTCAGAATAAGAGCGATTTAAGCGGCGGACGACAGGCTTCTAGTCAGCCTGTGGAACCTATATCGATA
CCCCCTCCACGTTTATTGTATCCTTACAATTTACCACCTCCCAACCCACCCACGACCCCGCGTACGACGAGAAGG
AAGATGTTGGCGGTTGAGATTCCGGAGAGTTTGAGGAGGAATTTGTTGTGGGAGAGACAGGTTAGTCAAGCGCAT
GCTAGGGGTCTTGGGAGACGACGTAGTATGAACGACGTGAAGGGTTGGCATATACCCAATCTTGTGAAGTTGACA
CCGAAAGGAGCGAAGCAGGATGAGCCGAATGATGTCCAGAAGGAGAGAGATAGGAGGTATCTTGCGAGAACGAGG
AGTTGGGCTTTCCAGTATCATGCTGTCGGATGGTGA
Gene >AgabiH97|087830
ATGGATTCGTTTCCTACGCCGGTCTTAGCCGCGGCTGCAGACGTCATAAAGCACGTCGACGGTGACGACTCACTC
CCCATCCTCTGGACCTGTCTGTATCACTTCCGCTGTCAGTTTTGTTACCTCAGTCTCACCTTCACCCTGCAGTCT
TCACCAAGTTCAAGGAGTCGCTTCAGGACGGCCACAGACTCGAGAACATATCCTGGCGCCTTTGGTATCAGTCCA
TGGTTGCCGCAAATTTTCCTCTCTCTAGTGACCTTTTGGAACCCCCTCCGGATGCATACCCCTTCTTTCTCAACG
AGACACCATATCGGCCGCTCACCCCCGACGAACTGCCTCGCCGTGCCTTCACTACTGATTGCTCGCCGTTGTCTT
CGCATGGTGAGAGCTTTTTTTACCAGCATCGACTGCTTTCAGCAGTTCCTGGGCTGCATATTCCATTTTCTGATT
TGTATTTACTAACTTTTCTCATCCGATCTTAGGTATAATAAATCCCCTACACACACCGCCTCTCGATGAGCAAAG
CACCGGCTCGTCATCAGTCGCATCGTCCCTCCCGAACTACTTTTCTCATAAGCCATTTTCTTCCACTCGGAGGAA
TAGCTTTAGGAAAGCATCGTCTCCTGTAAACGTGGGCAAAATTCTTTGCGAACTATTCCCTTCTGCCCCCGTTCC
CTCTTTGATGTCCCTAGGCTCCGGTTTCAGTAATGGACCAACCCTGCCGGTGGAATCGCCCCCAACGCAATATGG
TAATCTGCGAGCGTTATCTTCAGTGTCCCTCCCTTTATCCAGTCCCTTATCCCACTTTGTTGCCAACATTCGACA
TACCATCACGTCGGCAACAGAGAACGTTGGCCCACCACAGTCATTGCCTACGCCTGAAGCTGAAGAAGGTGACTC
CTCTTTGGGCCCAAGCTTATCGAAAGGCCTTGGCAGAACCGAGCCTCCTGCCATATTACCGGTAATCATGGCCGA
TAACTCGTCTCCTGCCAACAGACGCGATGAGCTGTTATCTACTGCACATGAACACCCTCCAAGTTTGCCACTACC
TCCCTTATTAGTCGTCGTCAAACCGACACCAGACCCCACTCCTCATCCCACTCCCCCGGCGACGCCAGTGCAACG
TCATTCTATTGTTGGCCAGGAGGAAGACGCGGACGCGGTGTCTTCGGTTCCGCGATTGAACATTCCAGGCCGTGG
TCAGCATGCACTAATTCAGGCGCAGACACGTGGGAGCAGATGCTCCCAATCACAGTCAACAGCGCAATTGGTTAT
AGCTGACGGAGATGGAAATCCACTTGCTTCTGGTACGAACTTAGCAAGTGCTCGGAATTACGACCCGACCGAAAG
TATGTGACTTCTTTTTTATTATAACTAAATGTTATCAACCCTATAAACGCAATTAAATGGATCGCTCATATATTT
GTTACTAGAGCTACCCATGATCCTCGCATTGCCTGCTTCGGCCAATTCGGAACGTGCTGCCCACCTAGTCTCGAA
TCTTCAATCTATTTCCTTGGATACTACAAGCTCCAGCTCGCAGCGCTCATCATTTACGCCATCGGAGTTTAGTAA
AGCTACGACTGCTACCACGATATCTGAGCCATACCACTGCACCCATCATATTGAAAAACGCTCTTTGTCATTCGT
ATCTTCACCTTCGCTTGATCAAGTTACCGCTGGTTCGGATACCGGTTTATTGCCGACATCTCCGCTTTATGAATC
GGAAATGGAATCATCTGCACCTAAGAGGCGTAAAGAGAAGGCTACTAGCTTGGGGTCTACAACTGGGAAGCTGTC
AGGTTCTTCGACTTCGAAAGCTCCTGGTTCCTTAACGTCAAATAAAGGAGCCTCTCCATCGTTTCGTCCAACGAA
CACAGCACGCAAACTGGGTAACAACAAAGGTGGCAATGAAGCAGGTGCAAGTACTGCTACCGGTCGTAGTCGAAC
ATCAAAAAGTCGGAGTAGAAGTAGGACGAGGGAGAGTGGAAATGCGGCGTTGCATGCTTTGGTGATGACGAGAGC
TGCTGCTTCTGGGCGAGGTGCTGCTGGGAAGGCAGCGATCAGGACGCGGAGTGGTGGAGGTGTGCGACGTGGTAA
AAGTGGTGTTGCGAAGAAGGTGAATATGAATGAAGTGGTGAGGGAGGGGGTTGTTATGTTCAATTTTGGTTCAAC
TTCAGAAGAGGGATCGAAAAGTACTGGAACTGGAAGTGGATCAGAAGTGATCGGGAGGCGCGAACGAGTGGAATC
GGGTCAGAACGACGAGGGAGTGGCGAAAATGATGGAGGATTCGTCGTCACATAAAGGCACAGATGTTGATGTGCC
TGCGCCTCCGCCGGTTGAGGAGAAGGCGGCGGTAGTGTCAACGGATAAAGAGAAGGGCAAGGGTAAAGAGAAGGC
GAAGTCTGGGGTTACTACAACTATCGAAGCCACCATTGCCGACCCATTGCTACCAGGCTCTGTTCGTCGGCAGAT
TGTGCTTACAAGTGACGACGATTCGGAGGGTTTCGAGACGGAAACGGATTCTTGGTCTGATACCGAAAGTGCTGA
TGCGCCTACGACCACTTCTCAACAACGGTTACCCACGGAAATGGAACAATCACAAGTACCTCAGCAGCCGCAACA
ACAACAACAACAACAACAACAACAGCGACAACAGCAACGCCAGCAACATCGTCCTACCCCTTCCCGTACTCACTC
CGATCACTTCCCTCGCAATAATCGACCTGTCACTCGTGCTTATCAAAGATTAGCTGAACAACGCGCGGCCGAGGA
CCGTAGGTGGAAGGAAGAAATGTTTGTCAAACTCCCGAAGGCATCGTTTGAGAACCTGGCGAAGATTAATAGGAC
CCGGAGTGGAGGATTACTGTCGCAGTTGCTGAAACCTGAAATTCAACCATTATCGACGGATCCTACTTATCGAAG
AGGATTCAGTTCTGGGGTTATTCAACCTCTTCGGCCGTTTACTCCCGTAGCGCAGCAGCAGCCACAGCCACAGCC
ACAGCAGCAGGTACAACCACAACAGCAGCAACAGACACAGACACAGCAACAGCAACAGACACAACACATCGGTCA
TAAACCTCCGTCTCCAGTTCCTGATACACAAGCTATTACCACCCAACAAATATCCTCCTCTCAACCCCCACCGCC
CATGGTTGTCGGCGATGCTCGACCTAGTCAGCATAGTCGACAACCTAGTCGGACGTATCAGCTTCCTAAACGCTT
AGCTGCTTTGACCAAGCCCTCCATCGTTGCTTCAAAGACACCGGTGGCATCAGCGGTGATGTCGGAGCTCCGCGT
TGGTAGTATTAACGGAGTCAAACAAGTGACGACGGGTGGCGTTAGTGTCAATGGGAGTGCTGGGAAGTATAAGCC
GAAGGGTCGACCCCCGGAGACCGTGATGGAGTATAGCAGTGATAGCGAGACTGATGATAACCAATTGGACTTGTC
GAAGAGTGTTGCACAGGAAAAGTTGAGGGCGCTGTTGGAGGCGAAGAAATTGAAAAAATCGGCACAGGGAGCCGA
TTCGAGTTTTCTTACCGATGAAGGTCAGAATAAGAGCGATTTAAGCGGCGGACGACAGGCTTCTAGTCAGCCTGT
GGAACCTATATCGATACCCCCTCCACGTTTATTGTATCCTTACAATTTACCACCTCCCAACCCACCCACGACCCC
GCGTACGACGAGAAGGAAGATGTTGGCGGTTGAGATTCCGGAGAGTTTGAGGAGGAATTTGTTGTGGGAGAGACA
GGTTAGTCAAGCGCATGCTAGGGGTCTTGGGAGACGACGTAGTATGAACGACGTGAAGGGTTGGCATATACCCAA
TCTTGTGAAGTTGACACCGAAAGGAGCGAAGCAGGATGAGCCGAATGATGTCCAGAAGGAGAGAGATAGGAGGTA
TCTTGCGAGAACGAGGAGTTGGGCTTTCCAGTATCATGCTGTCGGATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail