Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|087450
Gene name
Locationscaffold_5:2291612..2292871
Strand-
Gene length (bp)1259
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.6E-10 66 177
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 4.0E-07 71 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 14 240 5.0E-47
sp|P42840|YN60_YEAST Uncharacterized membrane protein YNL320W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL320W PE=1 SV=1 15 240 2.0E-34
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 35 240 7.0E-34
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 35 240 2.0E-33
sp|Q5ZJL8|ABHDD_CHICK Alpha/beta hydrolase domain-containing protein 13 OS=Gallus gallus GN=ABHD13 PE=2 SV=1 35 240 9.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 14 240 5.0E-47
sp|P42840|YN60_YEAST Uncharacterized membrane protein YNL320W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL320W PE=1 SV=1 15 240 2.0E-34
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 35 240 7.0E-34
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 35 240 2.0E-33
sp|Q5ZJL8|ABHDD_CHICK Alpha/beta hydrolase domain-containing protein 13 OS=Gallus gallus GN=ABHD13 PE=2 SV=1 35 240 9.0E-33
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 35 240 6.0E-32
sp|Q7L211|ABHDD_HUMAN Alpha/beta hydrolase domain-containing protein 13 OS=Homo sapiens GN=ABHD13 PE=2 SV=1 35 240 1.0E-28
sp|P77538|YFHR_ECOLI Uncharacterized protein YfhR OS=Escherichia coli (strain K12) GN=yfhR PE=3 SV=4 9 239 1.0E-19
sp|Q8XA81|YHFR_ECO57 Uncharacterized protein YfhR OS=Escherichia coli O157:H7 GN=yhfR PE=3 SV=4 9 239 6.0E-18
sp|P9WLC6|Y2307_MYCTO Uncharacterized protein MT2364 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2364 PE=4 SV=1 28 239 2.0E-15
sp|P9WLC7|Y2307_MYCTU Uncharacterized protein Rv2307c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2307c PE=1 SV=1 28 239 2.0E-15
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 69 234 4.0E-14
sp|Q4R766|ABD12_MACFA Monoacylglycerol lipase ABHD12 OS=Macaca fascicularis GN=ABHD12 PE=2 SV=1 65 234 4.0E-14
sp|Q8Z4M8|YHFR_SALTI Uncharacterized protein YfhR OS=Salmonella typhi GN=yhfR PE=3 SV=1 47 240 7.0E-14
sp|Q08C93|ABD12_DANRE Monoacylglycerol lipase ABHD12 OS=Danio rerio GN=abhd12 PE=2 SV=1 70 249 8.0E-14
sp|Q8ZN39|YFHR_SALTY Uncharacterized protein YfhR OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yfhR PE=3 SV=1 47 240 1.0E-13
sp|Q8N2K0|ABD12_HUMAN Monoacylglycerol lipase ABHD12 OS=Homo sapiens GN=ABHD12 PE=1 SV=2 71 234 1.0E-13
sp|Q6AYT7|ABD12_RAT Monoacylglycerol lipase ABHD12 OS=Rattus norvegicus GN=Abhd12 PE=2 SV=1 71 234 2.0E-13
sp|Q5ZIN0|ABD12_CHICK Monoacylglycerol lipase ABHD12 OS=Gallus gallus GN=ABHD12 PE=2 SV=1 70 234 3.0E-12
sp|B4F753|ABD12_XENTR Monoacylglycerol lipase ABHD12 OS=Xenopus tropicalis GN=abhd12 PE=2 SV=1 65 234 7.0E-12
sp|Q08DW9|ABD12_BOVIN Monoacylglycerol lipase ABHD12 OS=Bos taurus GN=ABHD12 PE=2 SV=1 65 234 8.0E-12
sp|Q7Z5M8|AB12B_HUMAN Abhydrolase domain-containing protein 12B OS=Homo sapiens GN=ABHD12B PE=2 SV=1 97 247 2.0E-11
sp|Q7ZVZ7|AB17C_DANRE Alpha/beta hydrolase domain-containing protein 17C OS=Danio rerio GN=abhd17c PE=2 SV=1 38 232 7.0E-11
sp|Q96GS6|AB17A_HUMAN Alpha/beta hydrolase domain-containing protein 17A OS=Homo sapiens GN=ABHD17A PE=1 SV=1 68 232 7.0E-11
sp|Q5ZJ01|AB17B_CHICK Alpha/beta hydrolase domain-containing protein 17B OS=Gallus gallus GN=ABHD17B PE=2 SV=1 48 232 8.0E-11
sp|Q6DEY3|AB17B_XENTR Alpha/beta hydrolase domain-containing protein 17B OS=Xenopus tropicalis GN=abhd17b PE=2 SV=1 48 232 1.0E-10
sp|Q6AY17|AB17B_RAT Alpha/beta hydrolase domain-containing protein 17B OS=Rattus norvegicus GN=Abhd17b PE=1 SV=1 51 232 1.0E-10
sp|Q7M759|AB17B_MOUSE Alpha/beta hydrolase domain-containing protein 17B OS=Mus musculus GN=Abhd17b PE=1 SV=1 51 232 1.0E-10
sp|Q5VST6|AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens GN=ABHD17B PE=1 SV=1 48 232 2.0E-10
sp|Q5XIJ5|AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus GN=Abhd17a PE=2 SV=1 41 232 2.0E-10
sp|Q99JW1|AB17A_MOUSE Alpha/beta hydrolase domain-containing protein 17A OS=Mus musculus GN=Abhd17a PE=1 SV=1 41 232 2.0E-10
sp|Q2HJ19|AB17A_BOVIN Alpha/beta hydrolase domain-containing protein 17A OS=Bos taurus GN=ABHD17A PE=2 SV=1 68 232 3.0E-10
sp|Q6DCC5|AB17B_XENLA Alpha/beta hydrolase domain-containing protein 17B OS=Xenopus laevis GN=abhd17b PE=2 SV=1 51 232 3.0E-10
sp|Q5ZJX1|AB17C_CHICK Alpha/beta hydrolase domain-containing protein 17C OS=Gallus gallus GN=ABHD17C PE=2 SV=1 50 232 4.0E-10
sp|Q8VCV1|AB17C_MOUSE Alpha/beta hydrolase domain-containing protein 17C OS=Mus musculus GN=Abhd17c PE=1 SV=2 50 232 4.0E-10
sp|Q6PCB6|AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens GN=ABHD17C PE=2 SV=2 50 232 4.0E-10
sp|A5PKD9|AB17C_BOVIN Alpha/beta hydrolase domain-containing protein 17C OS=Bos taurus GN=ABHD17C PE=2 SV=1 50 232 5.0E-10
sp|Q6GL10|AB17C_XENTR Alpha/beta hydrolase domain-containing protein 17C OS=Xenopus tropicalis GN=abhd17c PE=2 SV=1 57 232 6.0E-10
sp|Q6DD70|AB17C_XENLA Alpha/beta hydrolase domain-containing protein 17C OS=Xenopus laevis GN=abhd17c PE=2 SV=1 57 232 1.0E-09
sp|Q9KS12|MARTX_VIBCH Multifunctional-autoprocessing repeats-in-toxin OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rtxA PE=1 SV=2 63 215 1.0E-09
sp|Q5UQK4|YL404_MIMIV Putative alpha/beta hydrolase L404 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L404 PE=3 SV=1 67 232 3.0E-08
sp|Q5UP55|YR595_MIMIV Uncharacterized protein R595 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R595 PE=4 SV=1 10 276 9.0E-08
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 29 168 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|087450
MAVRLTPGFFVKKFLLHGQPFLVYPAAFWPLESPPKPSMWDLPYTDVVVTTSDNVQLKCYLIQHSTPRATVIMFH
GNGMNHGFMLYHSKKYFSLECNILTVSYRGYGDSQGVPSERGLQRDAQGALDWVLAHDELAGLPIVVYGLSLGGA
VAIDVASRNTDKIAALILENTFTSIPDIVHDWPIIGYFSFLCTQRWNSACKLARIPASLPILFLSGRSDYVVPPR
HMDNLWEIAKQRGRKKSGRKIARIHGGCWTSSQQTDGSDGENSEGPAIKDEEWSSPKKDQFISFSSGGHVDTYEE
RRYWPHVKKFLQHTLDSSSSSCT*
Coding >AgabiH97|087450
ATGGCTGTCCGGCTCACTCCCGGTTTCTTCGTCAAGAAGTTTCTGCTTCATGGTCAACCCTTTCTCGTCTATCCA
GCTGCGTTTTGGCCTCTAGAATCACCTCCGAAACCATCAATGTGGGACCTCCCATATACAGACGTTGTTGTCACG
ACCTCCGACAACGTACAGCTAAAATGTTATCTCATCCAACATTCAACACCAAGAGCGACCGTGATTATGTTTCAT
GGAAATGGAATGAACCATGGGTTCATGTTGTACCACTCAAAAAAATATTTTTCGTTGGAGTGTAACATTTTGACG
GTCTCGTACCGAGGCTATGGTGATAGCCAGGGGGTTCCTTCAGAAAGGGGATTGCAGAGAGACGCTCAAGGAGCT
CTGGACTGGGTTTTGGCTCATGACGAACTTGCGGGTTTACCTATCGTCGTGTACGGTCTTTCCTTAGGAGGTGCG
GTTGCTATTGACGTCGCGAGTAGAAACACAGACAAGATAGCGGCACTCATCTTAGAAAACACATTCACTTCAATT
CCTGATATCGTTCATGACTGGCCTATCATTGGATATTTTTCCTTCCTCTGTACTCAACGGTGGAATTCTGCCTGC
AAACTTGCTCGTATACCTGCTTCTCTCCCTATTTTATTTTTGTCAGGCAGGTCAGATTATGTTGTTCCACCCCGT
CATATGGACAATCTTTGGGAAATCGCGAAACAACGGGGAAGAAAGAAAAGTGGCCGGAAAATAGCTAGAATACAT
GGTGGATGCTGGACTTCGTCCCAGCAGACCGACGGTAGTGATGGTGAAAATTCTGAAGGGCCTGCAATAAAGGAC
GAAGAATGGAGCTCACCAAAGAAAGATCAGTTCATTTCTTTCAGTAGTGGCGGTCATGTTGATACATATGAAGAG
CGTCGATATTGGCCTCACGTAAAGAAGTTTTTACAACATACCCTTGATTCATCTTCATCTTCGTGCACGTGA
Transcript >AgabiH97|087450
ATGGCTGTCCGGCTCACTCCCGGTTTCTTCGTCAAGAAGTTTCTGCTTCATGGTCAACCCTTTCTCGTCTATCCA
GCTGCGTTTTGGCCTCTAGAATCACCTCCGAAACCATCAATGTGGGACCTCCCATATACAGACGTTGTTGTCACG
ACCTCCGACAACGTACAGCTAAAATGTTATCTCATCCAACATTCAACACCAAGAGCGACCGTGATTATGTTTCAT
GGAAATGGAATGAACCATGGGTTCATGTTGTACCACTCAAAAAAATATTTTTCGTTGGAGTGTAACATTTTGACG
GTCTCGTACCGAGGCTATGGTGATAGCCAGGGGGTTCCTTCAGAAAGGGGATTGCAGAGAGACGCTCAAGGAGCT
CTGGACTGGGTTTTGGCTCATGACGAACTTGCGGGTTTACCTATCGTCGTGTACGGTCTTTCCTTAGGAGGTGCG
GTTGCTATTGACGTCGCGAGTAGAAACACAGACAAGATAGCGGCACTCATCTTAGAAAACACATTCACTTCAATT
CCTGATATCGTTCATGACTGGCCTATCATTGGATATTTTTCCTTCCTCTGTACTCAACGGTGGAATTCTGCCTGC
AAACTTGCTCGTATACCTGCTTCTCTCCCTATTTTATTTTTGTCAGGCAGGTCAGATTATGTTGTTCCACCCCGT
CATATGGACAATCTTTGGGAAATCGCGAAACAACGGGGAAGAAAGAAAAGTGGCCGGAAAATAGCTAGAATACAT
GGTGGATGCTGGACTTCGTCCCAGCAGACCGACGGTAGTGATGGTGAAAATTCTGAAGGGCCTGCAATAAAGGAC
GAAGAATGGAGCTCACCAAAGAAAGATCAGTTCATTTCTTTCAGTAGTGGCGGTCATGTTGATACATATGAAGAG
CGTCGATATTGGCCTCACGTAAAGAAGTTTTTACAACATACCCTTGATTCATCTTCATCTTCGTGCACGTGA
Gene >AgabiH97|087450
ATGGCTGTCCGGCTCACTCCCGGTTTCTTCGTCAAGAAGGTAAGTATTGCTGTGTTTTACTTGGCTTCGCCTTGG
CTCAATGTCTGTTTTCTTCGATTCAAGTTTCTGCTTCATGGTCAACCCTTTCTCGTCTATCCAGCTGCGTTTTGG
CCTCTAGAATGTACTCCGCCTCCCTTGCTTTTGTTGTTATTCTCATAGCTGAAGTGCTCTCCTTCAGCACCTCCG
AAACCATCAATGTGGGACCTCCCATATACAGACGTTGTTGTCACGACCTCCGACAACGTACAGCTAAAATGTTAT
CTCATCCAACATTCAACACCAAGAGCGACCGTGATTATGTTTCATGGAAATGGAATGAACCATGGGTTCATGTTG
TACCACTCAAAAAAATATTTTTCGTTGGAGTGTAACATTTTGACGGTCTCGTACCGAGGCTATGGTGATAGCCAG
GGGGTTCCTTCAGAAAGGGGATTGCAGAGAGACGCTCAAGGAGCTCTGGACTGGGTTTTGGCTCATGACGAACTT
GCGGGTTTACCTATCGTACGTCTTTAAACCCAATAGTTTGGAAATCCGTTTCATTTTCTCTTTTAGGTCGTGTAC
GGTCTTTCCTTAGGAGGTGCGGTTGCTATTGACGTCGCGAGTAGAAACACAGACAAGGTGCGTTGTTATGTTCCC
TTCACACCTCCCACTGGGTATGACTTCTACAACTCGTTTCTAGATAGCGGCACTCATCTTAGAAAACACATTCAC
TTCAATTCCTGATATCGTTCATGACTGGCCTATCATTGGATATTTTTCCTTCCTCTGTACTCAACGGTGGAATTC
TGCCTGCAAACTTGCTCGTATACCTGCTTCTCTCCCTATTTTATTTTTGTCAGGCAGGTCAGATTATGTTGTTCC
ACCCCGTCATATGGACAATCTTTGGGAAATCGCGAAACAACGGGGAAGAAAGAAAAGTGGCCGGAAAATAGCTAG
AATACATGGTGGATGCTGGACTTCGTCCCAGCAGACCGACGGTAGTGATGGTGAAAATTCTGAAGGGCCTGCAAT
AAAGGACGAAGAATGGAGCTCACCAAAGAAAGATCAGTTCATTTCTTTCAGTAGTGGCGGTCATGGTGAGTGTTC
TAGCATCGTCACTGAAGATGTACCCTTACGGGCTGTTTTACCTAGTTGATACATATGAAGAGCGTCGATATTGGC
CTCACGTAAAGAAGTTTTTACAACATACCCTTGATTCATCTTCATCTTCGTGCACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail