Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|087370
Gene name
Locationscaffold_5:2261908..2264242
Strand+
Gene length (bp)2334
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature 1.8E-21 64 112
PF08544 GHMP_kinases_C GHMP kinases C terminal 2.9E-12 472 544
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 6.3E-11 195 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DN6|GALK_DICDI Galactokinase OS=Dictyostelium discoideum GN=galK PE=3 SV=1 70 570 7.0E-90
sp|P09608|GAL1_KLULA Galactokinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL1 PE=2 SV=2 75 572 5.0E-89
sp|Q9SEE5|GALK1_ARATH Galactokinase OS=Arabidopsis thaliana GN=GAL1 PE=1 SV=2 65 573 4.0E-83
sp|P04385|GAL1_YEAST Galactokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL1 PE=1 SV=4 64 573 1.0E-76
sp|Q9HDU2|GAL1_SCHPO Galactokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal1 PE=3 SV=1 65 570 8.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DN6|GALK_DICDI Galactokinase OS=Dictyostelium discoideum GN=galK PE=3 SV=1 70 570 7.0E-90
sp|P09608|GAL1_KLULA Galactokinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL1 PE=2 SV=2 75 572 5.0E-89
sp|Q9SEE5|GALK1_ARATH Galactokinase OS=Arabidopsis thaliana GN=GAL1 PE=1 SV=2 65 573 4.0E-83
sp|P04385|GAL1_YEAST Galactokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL1 PE=1 SV=4 64 573 1.0E-76
sp|Q9HDU2|GAL1_SCHPO Galactokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal1 PE=3 SV=1 65 570 8.0E-76
sp|Q68FH4|GALK2_MOUSE N-acetylgalactosamine kinase OS=Mus musculus GN=Galk2 PE=1 SV=1 65 572 8.0E-75
sp|Q5XIG6|GALK2_RAT N-acetylgalactosamine kinase OS=Rattus norvegicus GN=Galk2 PE=2 SV=1 65 571 1.0E-74
sp|Q5R6J8|GALK2_PONAB N-acetylgalactosamine kinase OS=Pongo abelii GN=GALK2 PE=2 SV=1 65 570 8.0E-73
sp|Q01415|GALK2_HUMAN N-acetylgalactosamine kinase OS=Homo sapiens GN=GALK2 PE=1 SV=1 65 570 9.0E-73
sp|O42821|GAL1_CANPA Galactokinase OS=Candida parapsilosis GN=GAL1 PE=3 SV=1 75 573 2.0E-72
sp|P13045|GAL3_YEAST Protein GAL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL3 PE=1 SV=2 65 572 2.0E-72
sp|P56091|GAL1_CANAX Galactokinase OS=Candida albicans GN=GAL1 PE=3 SV=1 75 570 6.0E-69
sp|P56599|GAL1_CANMA Galactokinase (Fragment) OS=Candida maltosa GN=GAL1 PE=3 SV=1 46 266 9.0E-25
sp|B9LFE4|GAL1_CHLSY Galactokinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=galK PE=3 SV=1 57 342 6.0E-22
sp|A9WB97|GAL1_CHLAA Galactokinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=galK PE=3 SV=1 57 342 6.0E-22
sp|A9MJI2|GAL1_SALAR Galactokinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=galK PE=3 SV=1 65 328 5.0E-21
sp|B4TQR9|GAL1_SALSV Galactokinase OS=Salmonella schwarzengrund (strain CVM19633) GN=galK PE=3 SV=1 65 328 2.0E-20
sp|Q8Z8B0|GAL1_SALTI Galactokinase OS=Salmonella typhi GN=galK PE=3 SV=1 65 328 2.0E-20
sp|B5QX45|GAL1_SALEP Galactokinase OS=Salmonella enteritidis PT4 (strain P125109) GN=galK PE=3 SV=1 65 328 2.0E-20
sp|B5FP41|GAL1_SALDC Galactokinase OS=Salmonella dublin (strain CT_02021853) GN=galK PE=3 SV=1 65 328 2.0E-20
sp|B4TC28|GAL1_SALHS Galactokinase OS=Salmonella heidelberg (strain SL476) GN=galK PE=3 SV=1 65 328 3.0E-20
sp|B2VBV2|GAL1_ERWT9 Galactokinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=galK PE=3 SV=1 59 330 3.0E-20
sp|P22713|GAL1_SALTY Galactokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galK PE=3 SV=2 65 328 3.0E-20
sp|B4SZH7|GAL1_SALNS Galactokinase OS=Salmonella newport (strain SL254) GN=galK PE=3 SV=1 65 328 3.0E-20
sp|B1LM48|GAL1_ECOSM Galactokinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=galK PE=3 SV=1 65 328 5.0E-20
sp|B5F052|GAL1_SALA4 Galactokinase OS=Salmonella agona (strain SL483) GN=galK PE=3 SV=1 65 328 6.0E-20
sp|A4W899|GAL1_ENT38 Galactokinase OS=Enterobacter sp. (strain 638) GN=galK PE=3 SV=1 65 344 6.0E-20
sp|B5BC50|GAL1_SALPK Galactokinase OS=Salmonella paratyphi A (strain AKU_12601) GN=galK PE=3 SV=1 65 328 6.0E-20
sp|Q5PG77|GAL1_SALPA Galactokinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=galK PE=3 SV=1 65 328 6.0E-20
sp|A9MTL0|GAL1_SALPB Galactokinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=galK PE=3 SV=1 65 328 7.0E-20
sp|B5R741|GAL1_SALG2 Galactokinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=galK PE=3 SV=1 65 300 1.0E-19
sp|A8AJ37|GAL1_CITK8 Galactokinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=galK PE=3 SV=1 65 328 1.0E-19
sp|C0PWW2|GAL1_SALPC Galactokinase OS=Salmonella paratyphi C (strain RKS4594) GN=galK PE=3 SV=1 65 328 1.0E-19
sp|Q0T6Y7|GAL1_SHIF8 Galactokinase OS=Shigella flexneri serotype 5b (strain 8401) GN=galK PE=3 SV=1 65 328 2.0E-19
sp|Q57RI3|GAL1_SALCH Galactokinase OS=Salmonella choleraesuis (strain SC-B67) GN=galK PE=3 SV=1 65 328 2.0E-19
sp|Q324G2|GAL1_SHIBS Galactokinase OS=Shigella boydii serotype 4 (strain Sb227) GN=galK PE=3 SV=1 65 328 2.0E-19
sp|Q3Z453|GAL1_SHISS Galactokinase OS=Shigella sonnei (strain Ss046) GN=galK PE=3 SV=1 65 328 2.0E-19
sp|Q83M01|GAL1_SHIFL Galactokinase OS=Shigella flexneri GN=galK PE=3 SV=3 65 328 2.0E-19
sp|Q32IG8|GAL1_SHIDS Galactokinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=galK PE=3 SV=1 65 328 2.0E-19
sp|B6I7R1|GAL1_ECOSE Galactokinase OS=Escherichia coli (strain SE11) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|P0A6T3|GAL1_ECOLI Galactokinase OS=Escherichia coli (strain K12) GN=galK PE=1 SV=2 65 328 3.0E-19
sp|B1IXX9|GAL1_ECOLC Galactokinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|C4ZXS8|GAL1_ECOBW Galactokinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|B7M6C0|GAL1_ECO8A Galactokinase OS=Escherichia coli O8 (strain IAI1) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|B5YRF5|GAL1_ECO5E Galactokinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|P0A6T4|GAL1_ECO57 Galactokinase OS=Escherichia coli O157:H7 GN=galK PE=3 SV=2 65 328 3.0E-19
sp|B7LAF8|GAL1_ECO55 Galactokinase OS=Escherichia coli (strain 55989 / EAEC) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|A7ZJD2|GAL1_ECO24 Galactokinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|Q1REH4|GAL1_ECOUT Galactokinase OS=Escherichia coli (strain UTI89 / UPEC) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|Q8FJS1|GAL1_ECOL6 Galactokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galK PE=3 SV=3 65 328 3.0E-19
sp|Q0TJU4|GAL1_ECOL5 Galactokinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|A1A900|GAL1_ECOK1 Galactokinase OS=Escherichia coli O1:K1 / APEC GN=galK PE=3 SV=1 65 328 3.0E-19
sp|B7MGL4|GAL1_ECO45 Galactokinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|A7ZY13|GAL1_ECOHS Galactokinase OS=Escherichia coli O9:H4 (strain HS) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|B7NNH9|GAL1_ECO7I Galactokinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|B7LK02|GAL1_ESCF3 Galactokinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=galK PE=3 SV=1 65 328 3.0E-19
sp|A7MIX5|GAL1_CROS8 Galactokinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=galK PE=3 SV=1 65 344 3.0E-19
sp|B2TUY8|GAL1_SHIB3 Galactokinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=galK PE=3 SV=1 65 328 6.0E-19
sp|B7N9Z9|GAL1_ECOLU Galactokinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=galK PE=3 SV=1 65 328 6.0E-19
sp|B7ULN0|GAL1_ECO27 Galactokinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=galK PE=3 SV=1 65 328 1.0E-18
sp|B7MPP1|GAL1_ECO81 Galactokinase OS=Escherichia coli O81 (strain ED1a) GN=galK PE=3 SV=1 65 328 1.0E-18
sp|B1JST8|GAL1_YERPY Galactokinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=galK PE=3 SV=1 61 331 2.0E-18
sp|A4TNR8|GAL1_YERPP Galactokinase OS=Yersinia pestis (strain Pestoides F) GN=galK PE=3 SV=1 61 331 2.0E-18
sp|Q1CFP0|GAL1_YERPN Galactokinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=galK PE=3 SV=1 61 331 2.0E-18
sp|A9R3B5|GAL1_YERPG Galactokinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=galK PE=3 SV=1 61 331 2.0E-18
sp|Q8ZGY3|GAL1_YERPE Galactokinase OS=Yersinia pestis GN=galK PE=3 SV=1 61 331 2.0E-18
sp|Q1C960|GAL1_YERPA Galactokinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=galK PE=3 SV=1 61 331 2.0E-18
sp|A7FKP2|GAL1_YERP3 Galactokinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=galK PE=3 SV=1 61 331 2.0E-18
sp|Q66D80|GAL1_YERPS Galactokinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=galK PE=3 SV=1 61 331 3.0E-18
sp|B2K8R6|GAL1_YERPB Galactokinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=galK PE=3 SV=1 61 331 3.0E-18
sp|A1JRX5|GAL1_YERE8 Galactokinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=galK PE=3 SV=1 61 331 5.0E-18
sp|A8GBA5|GAL1_SERP5 Galactokinase OS=Serratia proteamaculans (strain 568) GN=galK PE=3 SV=1 65 331 4.0E-17
sp|B4F0A6|GAL1_PROMH Galactokinase OS=Proteus mirabilis (strain HI4320) GN=galK PE=3 SV=1 58 300 7.0E-17
sp|A5UZX0|GAL1_ROSS1 Galactokinase OS=Roseiflexus sp. (strain RS-1) GN=galK PE=3 SV=1 65 328 1.0E-16
sp|A7NI09|GAL1_ROSCS Galactokinase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=galK PE=3 SV=1 65 328 2.0E-16
sp|A0KQH8|GAL1_AERHH Galactokinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=galK PE=3 SV=1 61 302 2.0E-16
sp|B8GCS2|GAL1_CHLAD Galactokinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=galK PE=3 SV=1 57 342 8.0E-15
sp|A7MV01|GAL1_VIBCB Galactokinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=galK PE=3 SV=1 58 331 8.0E-15
sp|C4LB24|GAL1_TOLAT Galactokinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=galK PE=3 SV=1 65 331 2.0E-14
sp|Q8R8R7|GAL1_CALS4 Galactokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=galK PE=3 SV=1 434 568 2.0E-14
sp|Q87M60|GAL1_VIBPA Galactokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=galK PE=3 SV=1 58 331 3.0E-14
sp|Q65UV5|GAL1_MANSM Galactokinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=galK PE=3 SV=1 409 553 3.0E-14
sp|Q7MI80|GAL1_VIBVY Galactokinase OS=Vibrio vulnificus (strain YJ016) GN=galK PE=3 SV=1 58 331 3.0E-14
sp|Q97EZ6|GAL1_CLOAB Galactokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=galK PE=3 SV=1 436 549 4.0E-14
sp|B3H1M3|GAL1_ACTP7 Galactokinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=galK PE=3 SV=1 426 552 5.0E-14
sp|P94169|GAL1_ACTPL Galactokinase OS=Actinobacillus pleuropneumoniae GN=galK PE=3 SV=1 426 552 5.0E-14
sp|A5UZX0|GAL1_ROSS1 Galactokinase OS=Roseiflexus sp. (strain RS-1) GN=galK PE=3 SV=1 434 549 6.0E-14
sp|Q8DBN9|GAL1_VIBVU Galactokinase OS=Vibrio vulnificus (strain CMCP6) GN=galK PE=3 SV=1 58 331 6.0E-14
sp|B0BPT5|GAL1_ACTPJ Galactokinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=galK PE=3 SV=1 435 552 8.0E-14
sp|P39574|GAL1_BACSU Galactokinase OS=Bacillus subtilis (strain 168) GN=galK PE=3 SV=1 436 568 1.0E-13
sp|A3N103|GAL1_ACTP2 Galactokinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=galK PE=3 SV=1 426 552 2.0E-13
sp|Q9KRP1|GAL1_VIBCH Galactokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=galK PE=3 SV=2 58 300 2.0E-13
sp|A5UDQ5|GAL1_HAEIE Galactokinase OS=Haemophilus influenzae (strain PittEE) GN=galK PE=3 SV=1 436 552 3.0E-13
sp|A5UHX0|GAL1_HAEIG Galactokinase OS=Haemophilus influenzae (strain PittGG) GN=galK PE=3 SV=1 436 552 3.0E-13
sp|C4LB24|GAL1_TOLAT Galactokinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=galK PE=3 SV=1 434 571 4.0E-13
sp|P31767|GAL1_HAEIN Galactokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galK PE=3 SV=2 436 552 4.0E-13
sp|A6M1P8|GAL1_CLOB8 Galactokinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=galK PE=3 SV=1 57 300 5.0E-13
sp|Q5LYY7|GAL1_STRT1 Galactokinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=galK PE=3 SV=1 436 549 6.0E-13
sp|B2G9P6|GAL1_LACRJ Galactokinase OS=Lactobacillus reuteri (strain JCM 1112) GN=galK PE=3 SV=1 64 344 6.0E-13
sp|A5VME2|GAL1_LACRD Galactokinase OS=Lactobacillus reuteri (strain DSM 20016) GN=galK PE=3 SV=1 64 344 6.0E-13
sp|A6M1P8|GAL1_CLOB8 Galactokinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=galK PE=3 SV=1 436 549 8.0E-13
sp|P57899|GAL1_PASMU Galactokinase OS=Pasteurella multocida (strain Pm70) GN=galK PE=3 SV=1 412 553 9.0E-13
sp|A7NI09|GAL1_ROSCS Galactokinase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=galK PE=3 SV=1 434 549 1.0E-12
sp|Q9ZB10|GAL1_STRTR Galactokinase OS=Streptococcus thermophilus GN=galK PE=3 SV=1 436 549 2.0E-12
sp|Q8RHD0|GAL1_FUSNN Galactokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=galK PE=3 SV=1 436 551 3.0E-12
sp|Q03JS8|GAL1_STRTD Galactokinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=galK PE=3 SV=1 436 549 4.0E-12
sp|B1YIH8|GAL1_EXIS2 Galactokinase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=galK PE=3 SV=1 433 544 4.0E-12
sp|B4TQR9|GAL1_SALSV Galactokinase OS=Salmonella schwarzengrund (strain CVM19633) GN=galK PE=3 SV=1 412 568 8.0E-12
sp|Q8Z8B0|GAL1_SALTI Galactokinase OS=Salmonella typhi GN=galK PE=3 SV=1 412 568 8.0E-12
sp|B5QX45|GAL1_SALEP Galactokinase OS=Salmonella enteritidis PT4 (strain P125109) GN=galK PE=3 SV=1 412 568 8.0E-12
sp|B5FP41|GAL1_SALDC Galactokinase OS=Salmonella dublin (strain CT_02021853) GN=galK PE=3 SV=1 412 568 8.0E-12
sp|B5F052|GAL1_SALA4 Galactokinase OS=Salmonella agona (strain SL483) GN=galK PE=3 SV=1 412 568 8.0E-12
sp|B5R741|GAL1_SALG2 Galactokinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=galK PE=3 SV=1 412 568 9.0E-12
sp|C0PWW2|GAL1_SALPC Galactokinase OS=Salmonella paratyphi C (strain RKS4594) GN=galK PE=3 SV=1 412 568 9.0E-12
sp|Q57RI3|GAL1_SALCH Galactokinase OS=Salmonella choleraesuis (strain SC-B67) GN=galK PE=3 SV=1 412 568 9.0E-12
sp|Q9R0N0|GALK1_MOUSE Galactokinase OS=Mus musculus GN=Galk1 PE=1 SV=2 412 544 9.0E-12
sp|A9MJI2|GAL1_SALAR Galactokinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=galK PE=3 SV=1 436 568 1.0E-11
sp|B4TC28|GAL1_SALHS Galactokinase OS=Salmonella heidelberg (strain SL476) GN=galK PE=3 SV=1 412 568 1.0E-11
sp|P22713|GAL1_SALTY Galactokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galK PE=3 SV=2 412 568 1.0E-11
sp|B4SZH7|GAL1_SALNS Galactokinase OS=Salmonella newport (strain SL254) GN=galK PE=3 SV=1 412 568 1.0E-11
sp|A9MTL0|GAL1_SALPB Galactokinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=galK PE=3 SV=1 412 568 1.0E-11
sp|B3H1M3|GAL1_ACTP7 Galactokinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=galK PE=3 SV=1 62 331 1.0E-11
sp|Q836P0|GAL1_ENTFA Galactokinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=galK PE=3 SV=1 392 544 1.0E-11
sp|B7LK02|GAL1_ESCF3 Galactokinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=galK PE=3 SV=1 436 568 2.0E-11
sp|A6H768|GALK1_BOVIN Galactokinase OS=Bos taurus GN=GALK1 PE=2 SV=2 412 544 2.0E-11
sp|B1LM48|GAL1_ECOSM Galactokinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|Q324G2|GAL1_SHIBS Galactokinase OS=Shigella boydii serotype 4 (strain Sb227) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|Q3Z453|GAL1_SHISS Galactokinase OS=Shigella sonnei (strain Ss046) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|Q83M01|GAL1_SHIFL Galactokinase OS=Shigella flexneri GN=galK PE=3 SV=3 436 568 3.0E-11
sp|B6I7R1|GAL1_ECOSE Galactokinase OS=Escherichia coli (strain SE11) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|P0A6T3|GAL1_ECOLI Galactokinase OS=Escherichia coli (strain K12) GN=galK PE=1 SV=2 436 568 3.0E-11
sp|B1IXX9|GAL1_ECOLC Galactokinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|C4ZXS8|GAL1_ECOBW Galactokinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|B7M6C0|GAL1_ECO8A Galactokinase OS=Escherichia coli O8 (strain IAI1) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|B5YRF5|GAL1_ECO5E Galactokinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|P0A6T4|GAL1_ECO57 Galactokinase OS=Escherichia coli O157:H7 GN=galK PE=3 SV=2 436 568 3.0E-11
sp|B7LAF8|GAL1_ECO55 Galactokinase OS=Escherichia coli (strain 55989 / EAEC) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|A7ZJD2|GAL1_ECO24 Galactokinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|B7NNH9|GAL1_ECO7I Galactokinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|B7N9Z9|GAL1_ECOLU Galactokinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|B7ULN0|GAL1_ECO27 Galactokinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|B7MPP1|GAL1_ECO81 Galactokinase OS=Escherichia coli O81 (strain ED1a) GN=galK PE=3 SV=1 436 568 3.0E-11
sp|Q9GKK4|GALK1_CANLF Galactokinase OS=Canis lupus familiaris GN=GALK1 PE=2 SV=1 412 544 3.0E-11
sp|A4W899|GAL1_ENT38 Galactokinase OS=Enterobacter sp. (strain 638) GN=galK PE=3 SV=1 436 568 4.0E-11
sp|B2TUY8|GAL1_SHIB3 Galactokinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=galK PE=3 SV=1 436 568 4.0E-11
sp|B4F0A6|GAL1_PROMH Galactokinase OS=Proteus mirabilis (strain HI4320) GN=galK PE=3 SV=1 433 574 4.0E-11
sp|Q0ST92|GAL1_CLOPS Galactokinase OS=Clostridium perfringens (strain SM101 / Type A) GN=galK PE=3 SV=1 289 549 4.0E-11
sp|B5BC50|GAL1_SALPK Galactokinase OS=Salmonella paratyphi A (strain AKU_12601) GN=galK PE=3 SV=1 412 569 5.0E-11
sp|Q5PG77|GAL1_SALPA Galactokinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=galK PE=3 SV=1 412 569 5.0E-11
sp|Q9KDV4|GAL1_BACHD Galactokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=galK PE=3 SV=1 434 572 5.0E-11
sp|A7MIX5|GAL1_CROS8 Galactokinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=galK PE=3 SV=1 412 568 6.0E-11
sp|Q9S6S2|GAL1_LACLM Galactokinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=galK PE=3 SV=1 434 549 6.0E-11
sp|A8AJ37|GAL1_CITK8 Galactokinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=galK PE=3 SV=1 412 568 7.0E-11
sp|Q1REH4|GAL1_ECOUT Galactokinase OS=Escherichia coli (strain UTI89 / UPEC) GN=galK PE=3 SV=1 436 568 8.0E-11
sp|Q8FJS1|GAL1_ECOL6 Galactokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galK PE=3 SV=3 436 568 8.0E-11
sp|Q0TJU4|GAL1_ECOL5 Galactokinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=galK PE=3 SV=1 436 568 8.0E-11
sp|A1A900|GAL1_ECOK1 Galactokinase OS=Escherichia coli O1:K1 / APEC GN=galK PE=3 SV=1 436 568 8.0E-11
sp|B7MGL4|GAL1_ECO45 Galactokinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=galK PE=3 SV=1 436 568 8.0E-11
sp|B0BPT5|GAL1_ACTPJ Galactokinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=galK PE=3 SV=1 62 331 8.0E-11
sp|Q9GKK4|GALK1_CANLF Galactokinase OS=Canis lupus familiaris GN=GALK1 PE=2 SV=1 65 289 8.0E-11
sp|B8F7C7|GAL1_HAEPS Galactokinase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=galK PE=3 SV=1 58 405 9.0E-11
sp|B7IDE2|GAL1_THEAB Galactokinase OS=Thermosipho africanus (strain TCF52B) GN=galK PE=3 SV=1 77 317 9.0E-11
sp|Q32IG8|GAL1_SHIDS Galactokinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=galK PE=3 SV=1 436 568 1.0E-10
sp|P94169|GAL1_ACTPL Galactokinase OS=Actinobacillus pleuropneumoniae GN=galK PE=3 SV=1 62 331 1.0E-10
sp|A3N103|GAL1_ACTP2 Galactokinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=galK PE=3 SV=1 62 331 1.0E-10
sp|Q9R7D7|GAL1_LACLA Galactokinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=galK PE=1 SV=1 434 549 1.0E-10
sp|Q0TQU5|GAL1_CLOP1 Galactokinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=galK PE=3 SV=1 289 549 1.0E-10
sp|Q8XKP9|GAL1_CLOPE Galactokinase OS=Clostridium perfringens (strain 13 / Type A) GN=galK PE=3 SV=1 289 549 1.0E-10
sp|B9LFE4|GAL1_CHLSY Galactokinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=galK PE=3 SV=1 472 571 2.0E-10
sp|A9WB97|GAL1_CHLAA Galactokinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=galK PE=3 SV=1 472 571 2.0E-10
sp|Q0T6Y7|GAL1_SHIF8 Galactokinase OS=Shigella flexneri serotype 5b (strain 8401) GN=galK PE=3 SV=1 436 568 2.0E-10
sp|A7ZY13|GAL1_ECOHS Galactokinase OS=Escherichia coli O9:H4 (strain HS) GN=galK PE=3 SV=1 436 568 2.0E-10
sp|P51570|GALK1_HUMAN Galactokinase OS=Homo sapiens GN=GALK1 PE=1 SV=1 412 544 2.0E-10
sp|B2GEP6|GAL1_LACF3 Galactokinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=galK PE=3 SV=1 64 346 2.0E-10
sp|Q97NZ6|GAL1_STRPN Galactokinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=galK PE=3 SV=1 436 549 2.0E-10
sp|Q97EZ6|GAL1_CLOAB Galactokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=galK PE=3 SV=1 58 300 3.0E-10
sp|A5UHX0|GAL1_HAEIG Galactokinase OS=Haemophilus influenzae (strain PittGG) GN=galK PE=3 SV=1 55 317 4.0E-10
sp|P31767|GAL1_HAEIN Galactokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galK PE=3 SV=2 55 317 4.0E-10
sp|B8F7C7|GAL1_HAEPS Galactokinase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=galK PE=3 SV=1 435 552 4.0E-10
sp|Q1WUZ4|GAL1_LACS1 Galactokinase OS=Lactobacillus salivarius (strain UCC118) GN=galK PE=3 SV=1 412 549 4.0E-10
sp|A0KQH8|GAL1_AERHH Galactokinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=galK PE=3 SV=1 435 553 5.0E-10
sp|Q9HHB6|GAL1_PYRFU Galactokinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=galK PE=1 SV=1 472 570 5.0E-10
sp|A5UDQ5|GAL1_HAEIE Galactokinase OS=Haemophilus influenzae (strain PittEE) GN=galK PE=3 SV=1 55 317 7.0E-10
sp|Q9R0N0|GALK1_MOUSE Galactokinase OS=Mus musculus GN=Galk1 PE=1 SV=2 65 289 7.0E-10
sp|P96993|GAL1_STRMU Galactokinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galK PE=3 SV=2 412 533 7.0E-10
sp|A4VT88|GAL1_STRSY Galactokinase OS=Streptococcus suis (strain 05ZYH33) GN=galK PE=3 SV=1 436 549 8.0E-10
sp|Q9K3S8|GAL1_STRCO Galactokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=galK PE=3 SV=1 433 568 8.0E-10
sp|Q87M60|GAL1_VIBPA Galactokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=galK PE=3 SV=1 436 568 1.0E-09
sp|P39574|GAL1_BACSU Galactokinase OS=Bacillus subtilis (strain 168) GN=galK PE=3 SV=1 79 320 1.0E-09
sp|Q9KRP1|GAL1_VIBCH Galactokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=galK PE=3 SV=2 436 568 2.0E-09
sp|Q8DNK7|GAL1_STRR6 Galactokinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=galK PE=3 SV=1 436 549 2.0E-09
sp|Q8VYG2|GALAK_ARATH Galacturonokinase OS=Arabidopsis thaliana GN=GALAK PE=1 SV=1 434 544 2.0E-09
sp|B2VBV2|GAL1_ERWT9 Galactokinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=galK PE=3 SV=1 436 569 3.0E-09
sp|Q7MI80|GAL1_VIBVY Galactokinase OS=Vibrio vulnificus (strain YJ016) GN=galK PE=3 SV=1 436 568 3.0E-09
sp|Q8DBN9|GAL1_VIBVU Galactokinase OS=Vibrio vulnificus (strain CMCP6) GN=galK PE=3 SV=1 436 568 3.0E-09
sp|A6H768|GALK1_BOVIN Galactokinase OS=Bos taurus GN=GALK1 PE=2 SV=2 65 289 3.0E-09
sp|Q49ZK2|GAL1_STAS1 Galactokinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=galK PE=3 SV=1 403 543 3.0E-09
sp|Q896X8|GAL1_CLOTE Galactokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=galK PE=3 SV=1 437 551 3.0E-09
sp|Q66D80|GAL1_YERPS Galactokinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=galK PE=3 SV=1 436 569 5.0E-09
sp|B2K8R6|GAL1_YERPB Galactokinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=galK PE=3 SV=1 436 569 5.0E-09
sp|A7MV01|GAL1_VIBCB Galactokinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=galK PE=3 SV=1 436 568 5.0E-09
sp|A6VQK2|GAL1_ACTSZ Galactokinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=galK PE=3 SV=1 436 552 5.0E-09
sp|B1JST8|GAL1_YERPY Galactokinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=galK PE=3 SV=1 436 569 7.0E-09
sp|A4TNR8|GAL1_YERPP Galactokinase OS=Yersinia pestis (strain Pestoides F) GN=galK PE=3 SV=1 436 569 7.0E-09
sp|Q1CFP0|GAL1_YERPN Galactokinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=galK PE=3 SV=1 436 569 7.0E-09
sp|A9R3B5|GAL1_YERPG Galactokinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=galK PE=3 SV=1 436 569 7.0E-09
sp|Q8ZGY3|GAL1_YERPE Galactokinase OS=Yersinia pestis GN=galK PE=3 SV=1 436 569 7.0E-09
sp|Q1C960|GAL1_YERPA Galactokinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=galK PE=3 SV=1 436 569 7.0E-09
sp|A7FKP2|GAL1_YERP3 Galactokinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=galK PE=3 SV=1 436 569 7.0E-09
sp|Q03PA8|GAL1_LACBA Galactokinase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=galK PE=3 SV=1 409 549 7.0E-09
sp|A6VQK2|GAL1_ACTSZ Galactokinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=galK PE=3 SV=1 59 346 1.0E-08
sp|P9WN63|GAL1_MYCTU Galactokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galK PE=3 SV=1 436 541 1.0E-08
sp|P9WN62|GAL1_MYCTO Galactokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galK PE=3 SV=1 436 541 1.0E-08
sp|A5U003|GAL1_MYCTA Galactokinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=galK PE=3 SV=1 436 541 1.0E-08
sp|C1AKV1|GAL1_MYCBT Galactokinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=galK PE=3 SV=1 436 541 1.0E-08
sp|A1KG98|GAL1_MYCBP Galactokinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=galK PE=3 SV=1 436 541 1.0E-08
sp|Q7U1L7|GAL1_MYCBO Galactokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=galK PE=3 SV=1 436 541 1.0E-08
sp|P13227|GAL1_STRLI Galactokinase OS=Streptomyces lividans GN=galK PE=3 SV=2 433 568 1.0E-08
sp|A1JRX5|GAL1_YERE8 Galactokinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=galK PE=3 SV=1 436 569 2.0E-08
sp|Q65UV5|GAL1_MANSM Galactokinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=galK PE=3 SV=1 65 331 2.0E-08
sp|Q03PA8|GAL1_LACBA Galactokinase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=galK PE=3 SV=1 58 335 2.0E-08
sp|Q5JEK8|GAL1_THEKO Galactokinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=galK PE=3 SV=1 440 570 2.0E-08
sp|Q03BB8|GAL1_LACC3 Galactokinase OS=Lactobacillus casei (strain ATCC 334) GN=galK PE=3 SV=1 405 544 2.0E-08
sp|B3W7I5|GAL1_LACCB Galactokinase OS=Lactobacillus casei (strain BL23) GN=galK PE=3 SV=1 405 544 2.0E-08
sp|O84902|GAL1_LACCA Galactokinase OS=Lactobacillus casei GN=galK PE=3 SV=1 405 544 2.0E-08
sp|B8GCS2|GAL1_CHLAD Galactokinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=galK PE=3 SV=1 475 571 4.0E-08
sp|O58107|GAL1_PYRHO Galactokinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=galK PE=1 SV=1 472 544 4.0E-08
sp|Q9RGS1|GAL1_STACT Galactokinase OS=Staphylococcus carnosus (strain TM300) GN=galK PE=3 SV=1 434 534 6.0E-08
sp|Q88SE8|GAL1_LACPL Galactokinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=galK PE=3 SV=1 434 544 8.0E-08
sp|B2GEP6|GAL1_LACF3 Galactokinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=galK PE=3 SV=1 434 544 9.0E-08
sp|Q00052|GAL1_LACHE Galactokinase OS=Lactobacillus helveticus GN=galK PE=3 SV=1 412 540 9.0E-08
sp|Q5E0M1|GAL1_VIBF1 Galactokinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=galK PE=3 SV=1 436 568 1.0E-07
sp|B5ETC9|GAL1_VIBFM Galactokinase OS=Vibrio fischeri (strain MJ11) GN=galK PE=3 SV=1 436 568 1.0E-07
sp|Q896X8|GAL1_CLOTE Galactokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=galK PE=3 SV=1 57 276 4.0E-07
sp|A8GBA5|GAL1_SERP5 Galactokinase OS=Serratia proteamaculans (strain 568) GN=galK PE=3 SV=1 436 569 2.0E-06
sp|O83433|GAL1_TREPA Putative galactokinase OS=Treponema pallidum (strain Nichols) GN=galK PE=3 SV=1 447 551 2.0E-06
sp|Q1WUZ4|GAL1_LACS1 Galactokinase OS=Lactobacillus salivarius (strain UCC118) GN=galK PE=3 SV=1 64 346 3.0E-06
sp|Q9K3S8|GAL1_STRCO Galactokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=galK PE=3 SV=1 65 276 3.0E-06
sp|Q9Y946|MVK_AERPE Mevalonate kinase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=mvk PE=3 SV=1 474 534 3.0E-06
sp|B2G9P6|GAL1_LACRJ Galactokinase OS=Lactobacillus reuteri (strain JCM 1112) GN=galK PE=3 SV=1 412 540 4.0E-06
sp|A5VME2|GAL1_LACRD Galactokinase OS=Lactobacillus reuteri (strain DSM 20016) GN=galK PE=3 SV=1 412 540 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|087370
MRHSVAFGTRFQENGFRHLAVTVTPLHGQRLKERPRASWSSGYIWNVRPEREVKFTQISPTSMEFEKRFGRPPAY
ITRAPGRINIIGEHIDYALFGVLPAAIEQDILIACAPRQPSDNSQEIHERPGSVVADNLNSKYTRQVFAPSQRAP
EGWHLEINTNELRWESYVKAGYYGVLSRYFPPDSNLHPTPVDLLATGSVPSGSGVSSSAAIVVASTLAFLAVNNK
LELTSGSTDAPLSKGELVKMAMENETRVGVNSGGMDQAASVMSVNSSALYITFFPILNTSPVPLPSGAKFVISNT
LVVADKVVTAKFRYNLRVVETLVGARILAHKLGVKLDTMEKVTYREVLGRIVKEQQDCGSDGDMGAGSLIVALKS
IMRSLTHLLPKGVDANAEGDERQMGLTMEEMIEMSGLSQQTFHEVYLSWIDVEATHFQLYKRAKHVFTEALRVLQ
FRKTSLDATDASPSLSLNPSTSLEKLGNLMNESQKSCRELFECSCPELDMLTKLCREAGAYGSRLTGAGWGGCAV
SLVAEDQVEIFIKKIKDEYPPYKGLKEEQLNDVIFATKPGSGACVYKFT*
Coding >AgabiH97|087370
ATGCGACATTCAGTAGCGTTCGGAACGAGGTTTCAAGAGAACGGTTTTCGGCATCTCGCGGTCACTGTGACGCCC
CTTCATGGTCAACGACTCAAAGAACGACCGCGAGCATCTTGGTCTTCGGGTTATATTTGGAATGTTCGGCCTGAG
CGGGAAGTCAAGTTTACACAAATCTCACCGACCTCTATGGAGTTTGAGAAACGCTTCGGCCGCCCACCGGCGTAT
ATCACGCGGGCTCCAGGACGGATCAATATTATAGGCGAACATATCGACTATGCGTTGTTCGGTGTCTTGCCTGCT
GCGATCGAGCAAGATATTCTCATAGCATGTGCTCCTCGCCAGCCCTCCGATAATAGTCAAGAAATACACGAAAGA
CCGGGTAGTGTAGTAGCAGATAATTTGAATTCTAAATACACTCGACAAGTTTTCGCTCCCAGTCAACGTGCACCA
GAAGGCTGGCACCTCGAGATCAACACAAATGAATTGAGATGGGAGAGCTACGTCAAGGCAGGATATTATGGCGTA
CTCTCCCGTTATTTTCCACCGGATAGTAATCTGCATCCAACTCCTGTGGATTTACTAGCCACTGGCTCAGTTCCT
TCTGGTTCAGGCGTGTCGTCCAGTGCGGCGATCGTCGTGGCGAGTACGTTAGCCTTCCTAGCGGTCAATAACAAG
CTCGAGCTCACTTCGGGTTCTACTGATGCGCCTCTGAGTAAAGGAGAACTCGTGAAAATGGCAATGGAAAATGAG
ACACGTGTAGGCGTCAATAGCGGAGGGATGGACCAAGCGGCTTCAGTCATGTCCGTCAACTCCTCAGCGCTCTAT
ATAACGTTCTTTCCCATACTCAATACCTCCCCGGTACCTCTTCCTTCTGGGGCGAAATTTGTCATCTCCAATACT
CTTGTGGTTGCAGATAAGGTGGTGACGGCAAAGTTTCGCTATAACCTCCGCGTGGTTGAAACTCTCGTCGGCGCA
CGCATACTGGCTCACAAATTAGGTGTCAAGCTAGATACCATGGAGAAAGTGACGTATAGAGAAGTCTTAGGTCGA
ATTGTTAAAGAACAGCAGGATTGCGGGAGCGACGGTGATATGGGAGCTGGTTCTTTGATTGTGGCCCTGAAAAGC
ATAATGAGGAGCCTTACGCATCTTCTGCCAAAAGGTGTAGATGCGAACGCTGAAGGAGATGAGCGGCAGATGGGG
TTGACAATGGAGGAAATGATTGAGATGAGTGGATTGAGTCAACAAACTTTCCACGAAGTATACCTCTCTTGGATC
GATGTCGAGGCCACTCACTTCCAGTTATACAAGCGAGCCAAACATGTATTCACTGAGGCACTACGTGTACTCCAA
TTTCGCAAGACAAGCCTTGACGCTACGGACGCGTCGCCTTCACTGAGCCTAAATCCGTCTACTTCGCTGGAGAAG
CTGGGAAATCTGATGAACGAGAGCCAGAAGAGCTGCAGGGAATTATTTGAATGCTCGTGCCCAGAGTTGGATATG
TTAACCAAGTTGTGTCGAGAAGCAGGAGCGTACGGCAGCCGGTTGACAGGTGCGGGGTGGGGTGGATGCGCGGTG
TCACTCGTTGCAGAGGACCAAGTTGAAATTTTCATCAAGAAGATTAAGGATGAGTATCCTCCGTATAAGGGTCTT
AAGGAAGAACAGCTAAACGATGTAATCTTTGCAACTAAGCCTGGAAGTGGAGCTTGTGTATATAAATTTACGTGA
Transcript >AgabiH97|087370
ATGCGACATTCAGTAGCGTTCGGAACGAGGTTTCAAGAGAACGGTTTTCGGCATCTCGCGGTCACTGTGACGCCC
CTTCATGGTCAACGACTCAAAGAACGACCGCGAGCATCTTGGTCTTCGGGTTATATTTGGAATGTTCGGCCTGAG
CGGGAAGTCAAGTTTACACAAATCTCACCGACCTCTATGGAGTTTGAGAAACGCTTCGGCCGCCCACCGGCGTAT
ATCACGCGGGCTCCAGGACGGATCAATATTATAGGCGAACATATCGACTATGCGTTGTTCGGTGTCTTGCCTGCT
GCGATCGAGCAAGATATTCTCATAGCATGTGCTCCTCGCCAGCCCTCCGATAATAGTCAAGAAATACACGAAAGA
CCGGGTAGTGTAGTAGCAGATAATTTGAATTCTAAATACACTCGACAAGTTTTCGCTCCCAGTCAACGTGCACCA
GAAGGCTGGCACCTCGAGATCAACACAAATGAATTGAGATGGGAGAGCTACGTCAAGGCAGGATATTATGGCGTA
CTCTCCCGTTATTTTCCACCGGATAGTAATCTGCATCCAACTCCTGTGGATTTACTAGCCACTGGCTCAGTTCCT
TCTGGTTCAGGCGTGTCGTCCAGTGCGGCGATCGTCGTGGCGAGTACGTTAGCCTTCCTAGCGGTCAATAACAAG
CTCGAGCTCACTTCGGGTTCTACTGATGCGCCTCTGAGTAAAGGAGAACTCGTGAAAATGGCAATGGAAAATGAG
ACACGTGTAGGCGTCAATAGCGGAGGGATGGACCAAGCGGCTTCAGTCATGTCCGTCAACTCCTCAGCGCTCTAT
ATAACGTTCTTTCCCATACTCAATACCTCCCCGGTACCTCTTCCTTCTGGGGCGAAATTTGTCATCTCCAATACT
CTTGTGGTTGCAGATAAGGTGGTGACGGCAAAGTTTCGCTATAACCTCCGCGTGGTTGAAACTCTCGTCGGCGCA
CGCATACTGGCTCACAAATTAGGTGTCAAGCTAGATACCATGGAGAAAGTGACGTATAGAGAAGTCTTAGGTCGA
ATTGTTAAAGAACAGCAGGATTGCGGGAGCGACGGTGATATGGGAGCTGGTTCTTTGATTGTGGCCCTGAAAAGC
ATAATGAGGAGCCTTACGCATCTTCTGCCAAAAGGTGTAGATGCGAACGCTGAAGGAGATGAGCGGCAGATGGGG
TTGACAATGGAGGAAATGATTGAGATGAGTGGATTGAGTCAACAAACTTTCCACGAAGTATACCTCTCTTGGATC
GATGTCGAGGCCACTCACTTCCAGTTATACAAGCGAGCCAAACATGTATTCACTGAGGCACTACGTGTACTCCAA
TTTCGCAAGACAAGCCTTGACGCTACGGACGCGTCGCCTTCACTGAGCCTAAATCCGTCTACTTCGCTGGAGAAG
CTGGGAAATCTGATGAACGAGAGCCAGAAGAGCTGCAGGGAATTATTTGAATGCTCGTGCCCAGAGTTGGATATG
TTAACCAAGTTGTGTCGAGAAGCAGGAGCGTACGGCAGCCGGTTGACAGGTGCGGGGTGGGGTGGATGCGCGGTG
TCACTCGTTGCAGAGGACCAAGTTGAAATTTTCATCAAGAAGATTAAGGATGAGTATCCTCCGTATAAGGGTCTT
AAGGAAGAACAGCTAAACGATGTAATCTTTGCAACTAAGCCTGGAAGTGGAGCTTGTGTATATAAATTTACGTGA
Gene >AgabiH97|087370
ATGCGACATTCAGTAGCGTTCGGAACGAGGTTTCAAGAGAACGGTTTTCGGCATCTCGCGGTCACTGTGACGCCC
GTGTGCCAAGGTTGTTTCGCCAACGTCAACTAGAACTTGTCCTTCAAAGCTTCATGGTCAACGACTCAAAGAACG
ACCGCGAGCATCTTGGTCTTCGGGTTATATTTGGAATGTTCGGCCTGAGCGGGAAGTCAAGGTACGTGTGATTAC
TTACAAAGTTGCAGTGAGCACATGGTCTTTCCTTCTCTTCTACATCATTACTATGCGCCTTGCTGATCAGTCCAT
TCCAGTTTACACAAATCTCACCGACCTCTATGGTTCGCTAGGTTCCTCCGTTAACCACGCAGAACGTTGGGACAA
CCTCGCAAAGGAGTTTGAGAAACGCTTCGGCCGCCCACCGGCGTATATCACGCGGGCTCCAGGACGGATCAAGTG
AGTGACCAGTCTTATCAGCTCTTCATCTGTATTGATGGATACGCTAGTATTATAGGTAAGCATCGTGCCATCCAG
AAGTGTAAAGCCTACTTAGATCCCTCTGGTAAGGCGAACATATCGACTATGCGTTGTTCGGTGTCTTGCCTGCTG
CGATCGAGCAAGATATTCTCATAGCATGTGCTCCTCGCCAGCCCTCCGATAATAGTCAAGAAATACACGAAAGAC
CGGGTAGTGTAGTAGCAGATAATTTGAATTCTAAATACACTCGACAAGTTTTCGCTCCCAGTCAACGTGCACCAG
AAGGCTGGCACCTCGAGATCAACACAAATGAATTGAGATGGGAGAGCTACGTCAAGGCAGGATATTATGTGCGTA
TAGTGGTGGATACCGTCTCTTCATTGCTGATGTATCATTAGGGCGTACTCTCCCGTTATTTTCCACCGGATAGTA
ATCTGCATCCAACTCCTGTGGATTTACTAGCCACTGGCTCAGTTCCTTCTGGTTCAGGCGTGTCGTCCAGTGCGG
CGATCGTCGTGGCGAGTACGTTAGCCTTCCTAGCGGTCAATAACAAGGTATGTCTTCCACCGATAAATTAGAAAA
CGACTCAGATATATTGATAGCTCGAGCTCACTTCGGGTTCTACTGATGCGCCTCTGAGTAAAGGAGAACTCGTGA
AAATGGCAATGGAAAATGAGACACGTGTAGGCGTCAATAGCGGAGGGTATGTGCCTTCAATTCGGTTCAATAGAC
ATCGATCAGACAAAATAACCTTACAGGATGGACCAAGCGGCTTCAGTCATGTCCGTCAACTCCTCAGCGCTCTAT
ATAACGTTCTTTCCCATACTCAATACCTCCCCGGTACCTCTTCCTTCTGGGGCGAAATTTGTCATCTCCAATACT
CTTGTGGTTGCAGATAAGGTGGTGACGGCAAAGTTTCGCTATAACCTCCGCGTGGTTGAAACTCTCGTCGGCGCA
CGCATACTGGCTCACAAATTAGGTGTCAAGCTAGATACCATGGAGAAAGTGACGTATAGAGAAGTCTTAGGTCGA
ATTGTTAAAGAACAGCAGGATTGCGGGAGCGACGGTGATATGGGAGCTGGTTCTTTGATTGTGGCCCTGAAAAGC
ATAATGAGGAGCCTTACGCATCTTCTGCCAAAAGGTGTAGATGCGAACGCTGAAGGAGATGAGCGGCAGATGGGG
TTGACAATGGAGGAAATGATTGAGATGAGTGGATTGAGTCAACAAACTTTCCACGAAGTATACCTCTCTTGGATC
GATGGTGCGTCATCTTGATATCAGTTCGATTCGTTCCAGCTCATACCCTCATTCTCAGTCGAGGCCACTCACTTC
CAGTTATACAAGCGAGCCAAACATGTATTCACTGAGGCACTACGTGTACTCCAATTTCGCAAGACAAGCCTTGAC
GCTACGGACGCGTCGCCTTCACTGAGCCTAAATCCGTCTACTTCGCTGGAGAAGCTGGGAAATCTGATGAACGAG
AGCCAGAAGAGCTGCAGGGAATTATTTGAATGCTCGTGCCCAGAGTTGGATATGTTAACCAAGTTGTGTCGAGAA
GCAGGAGCGTACGGCAGCCGGTTGACAGGTATGCTTCTGTTCGTCATCTAAGAAGCGAACTTAATATCTCAATCA
ATCAAGGTGCGGGGTGGGGTGGATGCGCGGTGTCACTCGTTGCAGAGGACCAAGTTGAAATTTTCATCAAGAAGA
TTAAGGATGAGTATCCTCCGTATAAGGGTCTTAAGGAAGAACAGCTAAACGATGTAATCTTTGCAACTAAGCCTG
GAAGTGGAGCTTGTGGTATGCGCTTCCTTCGTTTTTTGAGACTCTTGAGCTAATTGACTTCATACAGTATATAAA
TTTACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail