Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|087310
Gene name
Locationscaffold_5:2249069..2250914
Strand+
Gene length (bp)1845
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain 9.7E-11 310 453

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y6F1|PARP3_HUMAN Poly [ADP-ribose] polymerase 3 OS=Homo sapiens GN=PARP3 PE=1 SV=3 270 426 1.0E-06

GO

GO Term Description Terminal node
GO:0003950 NAD+ ADP-ribosyltransferase activity Yes
GO:0016763 pentosyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|087310
MAAHVPTFLSLLSTAASAYPAIAKFASNSSAPPAPPAPPPPTAPSQQHTSNALAPSAPVNVPGSLQPQSNNGPVT
MGSPPNQGNPFCDYCSLRPKYSDSGRLHPYCSKTCASKDKRKNWTPAMGNQPPQLAVPGAFCEHCLVNVKYFDGT
KTHPFCSKACAKKANRKQSLNVTIPAPKPPGICQAPNCQSQVYTNSNGSLGEYCSIAHKTLGETLCLMCLQAPKT
TLSHFCSQTCIDKVEKLGSTILEVPVGHVTFKSVADQFKSSWRHNSQCPSVRRIYKICFPPSSLAAYNTYKSSVE
ARGQFASQGRSAGNENRRWHGTRRECHLGDKGNTQLCASSTCSLCSIVKNSYDLSLFGKKTGWGRFGRGIYTSST
SSKSNDYSQNDCKSNLKAILLNKVVVGKGHKLTHDLTSLTAPPHGFDSVLAERGGSLNYDELVVYTNDAIRPSFL
VMYEL*
Coding >AgabiH97|087310
ATGGCGGCACATGTTCCCACTTTTCTATCTCTCCTCAGCACTGCCGCGTCTGCGTATCCCGCTATCGCGAAGTTC
GCTAGCAACTCATCGGCACCACCAGCACCACCAGCACCACCTCCACCAACCGCTCCCTCCCAGCAGCACACATCG
AATGCTCTTGCACCTTCTGCACCCGTAAACGTCCCCGGATCTCTCCAGCCGCAGTCAAACAATGGGCCGGTAACG
ATGGGTAGTCCCCCGAACCAGGGAAACCCTTTCTGCGACTATTGTTCTCTTAGGCCCAAATACTCCGACAGTGGC
AGGCTTCATCCTTATTGCAGCAAGACGTGCGCAAGTAAAGATAAGCGGAAGAATTGGACGCCGGCCATGGGCAAC
CAACCTCCGCAGCTGGCAGTTCCTGGAGCCTTTTGCGAGCATTGCCTCGTCAACGTGAAGTACTTCGACGGCACG
AAGACGCACCCGTTCTGTAGTAAAGCCTGTGCTAAGAAGGCGAATCGGAAACAAAGCTTGAATGTAACTATACCC
GCGCCCAAGCCTCCAGGAATATGCCAAGCGCCGAATTGTCAAAGTCAAGTATATACAAATTCTAATGGCTCTCTT
GGCGAATATTGTTCAATAGCTCATAAGACCCTTGGAGAAACCCTCTGCCTCATGTGTCTTCAAGCTCCCAAGACG
ACGTTATCCCATTTTTGTAGTCAGACATGTATTGATAAGGTAGAGAAATTGGGGTCGACGATTCTCGAGGTTCCT
GTTGGTCACGTCACCTTTAAGAGTGTGGCGGACCAATTCAAGTCATCGTGGCGCCATAATTCTCAATGTCCTTCT
GTCCGTCGAATTTACAAGATATGTTTTCCCCCCTCTTCCCTCGCCGCATACAATACCTACAAATCTTCTGTGGAA
GCTCGCGGACAGTTCGCGAGTCAAGGAAGATCTGCCGGAAACGAGAACCGCCGTTGGCACGGAACGCGGCGAGAA
TGCCATCTCGGAGACAAGGGCAACACCCAACTATGCGCATCGTCTACGTGTTCTTTATGTTCCATCGTTAAGAAT
TCGTACGATCTTAGTCTCTTCGGAAAGAAAACCGGATGGGGAAGATTCGGTCGCGGGATTTATACCTCTTCGACG
TCTTCCAAGTCGAATGATTACTCGCAGAATGATTGCAAATCGAATCTCAAAGCTATTCTGCTCAACAAGGTCGTC
GTCGGGAAGGGACACAAGCTGACACATGACCTTACGAGTCTCACTGCGCCCCCTCATGGCTTTGACTCCGTACTT
GCTGAAAGAGGCGGAAGTCTGAATTATGATGAACTCGTTGTATACACGAATGACGCTATCCGACCCTCATTCTTG
GTCATGTATGAGCTTTAG
Transcript >AgabiH97|087310
ATGGCGGCACATGTTCCCACTTTTCTATCTCTCCTCAGCACTGCCGCGTCTGCGTATCCCGCTATCGCGAAGTTC
GCTAGCAACTCATCGGCACCACCAGCACCACCAGCACCACCTCCACCAACCGCTCCCTCCCAGCAGCACACATCG
AATGCTCTTGCACCTTCTGCACCCGTAAACGTCCCCGGATCTCTCCAGCCGCAGTCAAACAATGGGCCGGTAACG
ATGGGTAGTCCCCCGAACCAGGGAAACCCTTTCTGCGACTATTGTTCTCTTAGGCCCAAATACTCCGACAGTGGC
AGGCTTCATCCTTATTGCAGCAAGACGTGCGCAAGTAAAGATAAGCGGAAGAATTGGACGCCGGCCATGGGCAAC
CAACCTCCGCAGCTGGCAGTTCCTGGAGCCTTTTGCGAGCATTGCCTCGTCAACGTGAAGTACTTCGACGGCACG
AAGACGCACCCGTTCTGTAGTAAAGCCTGTGCTAAGAAGGCGAATCGGAAACAAAGCTTGAATGTAACTATACCC
GCGCCCAAGCCTCCAGGAATATGCCAAGCGCCGAATTGTCAAAGTCAAGTATATACAAATTCTAATGGCTCTCTT
GGCGAATATTGTTCAATAGCTCATAAGACCCTTGGAGAAACCCTCTGCCTCATGTGTCTTCAAGCTCCCAAGACG
ACGTTATCCCATTTTTGTAGTCAGACATGTATTGATAAGGTAGAGAAATTGGGGTCGACGATTCTCGAGGTTCCT
GTTGGTCACGTCACCTTTAAGAGTGTGGCGGACCAATTCAAGTCATCGTGGCGCCATAATTCTCAATGTCCTTCT
GTCCGTCGAATTTACAAGATATGTTTTCCCCCCTCTTCCCTCGCCGCATACAATACCTACAAATCTTCTGTGGAA
GCTCGCGGACAGTTCGCGAGTCAAGGAAGATCTGCCGGAAACGAGAACCGCCGTTGGCACGGAACGCGGCGAGAA
TGCCATCTCGGAGACAAGGGCAACACCCAACTATGCGCATCGTCTACGTGTTCTTTATGTTCCATCGTTAAGAAT
TCGTACGATCTTAGTCTCTTCGGAAAGAAAACCGGATGGGGAAGATTCGGTCGCGGGATTTATACCTCTTCGACG
TCTTCCAAGTCGAATGATTACTCGCAGAATGATTGCAAATCGAATCTCAAAGCTATTCTGCTCAACAAGGTCGTC
GTCGGGAAGGGACACAAGCTGACACATGACCTTACGAGTCTCACTGCGCCCCCTCATGGCTTTGACTCCGTACTT
GCTGAAAGAGGCGGAAGTCTGAATTATGATGAACTCGTTGTATACACGAATGACGCTATCCGACCCTCATTCTTG
GTCATGTATGAGCTTTAG
Gene >AgabiH97|087310
ATGGCGGCACATGTTCCCACTTTTCTATCTCTCCTCAGCACTGCCGCGTCTGCGTATCCCGCTATCGCGAAGTTC
GCTAGCAACTCATCGGCACCACCAGCACCACCAGCACCACCTCCACCAACCGCTCCCTCCCAGCAGCACACATCG
AATGCTCTTGCACCTTCTGCACCCGTAAACGTCCCCGGATCTCTCCAGCCGCAGTCAAACAATGGGCCGGTAACG
ATGGGTAGTCCCCCGAACCAGGGAAACCCTTTCTGCGACGTAAGTGTTATGTCCTTAATAACGTGTTGACCTAGC
TAATCTGGTAATCCAGTATTGTTCTCTTAGGCCCAAATACTCCGACAGTGGCAGGCTTCATCCTTATTGCAGCAA
GACGTGCGCAAGTAAAGATAAGCGGAAGAATTGGACGCCGGCCATGGGCAACCAACCTCCGCAGCTGGCAGTTCC
TGGAGCCTTTTGCGAGGTGGGTGACTTCTTGCTTTATGCTCATAGACTGACGACTCAAAATGGAATGATAGCATT
GCCTCGTCAACGTGAAGTACTTCGACGGCACGAAGACGCACCCGTTCTGTAGTAAAGCCTGTGCTAAGAAGGCGA
ATCGGAAACAAAGCTTGAATGTAACTATACCCGCGCCCAAGCGTGAGTGAACTTACCTCAGGTTATTGGTATACT
ATAGCTGAATATCTTAAAGCTCCAGGAATATGCCAAGCGCCGAATTGTCAAAGTCAAGTATATACAAATTCTAAT
GGCTCTCTTGGCGAATATTGTTCAATAGCTCATAAGACGTAAGTCGGCCTAGCGTACCGGTAATGTTCTTGCTTT
CAAACTTCGATCACTAGCCTTGGAGAAACCCTCTGCCTCATGTGTCTTCAAGCTCCCAAGACGACGTTATCCCAT
TTTTGTAGTCAGACATGTATTGATAAGGTAGAGAAATTGGGGTCGACGATTCTCGAGGTTCCTGTTGGTCACGTC
ACCTTTAAGAGTGGTAAGCGTTCCCTTGGAATCAATGCTATAGTTAATGCTAAAATCAACCAGTGGCGGACCAAT
TCAAGTCATCGTGGCGCCATAATTCTCAATGTCCTTCTGTCCGTCGAATTTACAAGATATGTTTTCCCCCCTCTT
CCCTCGCCGCATACAATACCTACAAGTACGGTCAAGTTTATTCTTGGATCCGACGTTCAAATATCTCATAAATTT
TTTTAAATCACAGATCTTCTGTGGAAGCTCGCGGACAGTTCGCGAGTCAAGGAAGATCTGCCGGAAACGAGAACC
GCCGTTGGCACGGAACGCGGCGAGAATGCCATCTCGGAGACAAGGGCAACACCCAACTATGCGCATCGTCTACGT
GTTCTTTATGTTCCATCGTTAAGAATTCGTACGATCTTAGTCTCTTCGGAAAGAAAACCGGATGGGGAAGGTAAT
ATAGCTTCCCGTTTGCCTAGATTTGACATTGATCCCTTGCCAGATTCGGTCGCGGGATTTATACCTCTTCGACGT
CTTCCAAGTACGATTGTTACACTCTTTTCCCTTTTCCTTGTCTTAACGCCACATAGGTCGAATGATTACTCGCAG
AATGATTGCAAATCGAATCTCAAAGCTATTCTGCTCAACAAGGTCGTCGTCGGGAAGGGACACAAGCTGACACAT
GACCTTACGAGTCTCACTGCGCCCCCTCATGGCTTTGACTCCGTACGTCTGCAGATATTATGTATTATGATAAAA
GTTCACTTTTTTTTGTTTCAGGTACTTGCTGAAAGAGGCGGAAGTCTGAATTATGATGAACTCGTTGTATACACG
AATGACGCTATCCGACCCTCATTCTTGGTCATGTATGAGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail