Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|086810
Gene name
Locationscaffold_5:2126285..2127197
Strand+
Gene length (bp)912
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 2.0E-07 167 254
PF13650 Asp_protease_2 Aspartyl protease 3.8E-07 167 256

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4983 0.6201 0.3761 0.0881 0.021 0.0429 0.0438 0.149 0.0321 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup85
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|291900
Agaricus bisporus var bisporus H97 AgabiH97|039720
Agaricus bisporus var bisporus H97 AgabiH97|086810 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|089510
Agaricus bisporus var bisporus H97 AgabiH97|098710
Agaricus bisporus var bisporus H97 AgabiH97|107800
Rhodonia placenta FPRL280 RhoplFPRL280|1232_2
Rhodonia placenta FPRL280 RhoplFPRL280|1518_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|086810
MKPVVELPPLPAKYFKEEKKGPSYKQQAKIEEGISIEEMLEKFGETEIKLSQKELLGMAPKLREALKDLLSKRRV
PTGNNNIVVDRDQEEEEQLDWTYASLNKLGTVQKIQTEAKNKEGNPVKVWEVKEPLTQYLTAVPAEKRERLVFTI
EKEESQSAETMGELRVIPATINGVREEEALLDSGSQIVTMSREAASECKLAWDPSMAINMQSANGGITRTCGLAK
NVPFLFGTITAYLQVHVIEDAPYRVLLGRPFDVLLESKITNSGTGHQFITITDPNTKEWASLATYAKGELPRTLE
TNF*
Coding >AgabiH97|086810
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAGACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTAGGAATGGCACCAAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCCACTGGTAACAACAATATTGTTGTTGATAGGGACCAAGAAGAAGAAGAACAGCTTGATTGGACCTACGCTAGT
CTTAACAAGCTAGGGACGGTACAAAAGATACAGACAGAAGCTAAGAATAAAGAAGGGAACCCAGTGAAAGTTTGG
GAAGTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGCCGAAAAGCGAGAGAGATTGGTGTTCACCATA
GAAAAAGAGGAGTCTCAGAGCGCCGAGACAATGGGGGAGTTACGCGTAATACCAGCAACCATTAATGGAGTCCGT
GAGGAAGAAGCGTTGTTGGATAGCGGATCTCAGATTGTCACGATGAGTAGAGAGGCTGCTAGTGAATGTAAGCTA
GCATGGGACCCATCTATGGCGATTAATATGCAAAGCGCTAATGGAGGGATCACCCGAACATGTGGGCTAGCTAAG
AATGTTCCCTTCCTCTTCGGAACAATCACGGCGTACCTACAGGTGCATGTTATCGAAGATGCACCTTATCGAGTA
CTACTAGGAAGACCGTTTGACGTTCTACTAGAAAGTAAGATAACGAACTCAGGAACAGGGCACCAGTTCATCACC
ATAACTGACCCGAATACAAAAGAATGGGCCTCGCTAGCTACTTATGCAAAAGGAGAGCTACCGAGGACATTGGAA
ACAAATTTTTAA
Transcript >AgabiH97|086810
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAGACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTAGGAATGGCACCAAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCCACTGGTAACAACAATATTGTTGTTGATAGGGACCAAGAAGAAGAAGAACAGCTTGATTGGACCTACGCTAGT
CTTAACAAGCTAGGGACGGTACAAAAGATACAGACAGAAGCTAAGAATAAAGAAGGGAACCCAGTGAAAGTTTGG
GAAGTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGCCGAAAAGCGAGAGAGATTGGTGTTCACCATA
GAAAAAGAGGAGTCTCAGAGCGCCGAGACAATGGGGGAGTTACGCGTAATACCAGCAACCATTAATGGAGTCCGT
GAGGAAGAAGCGTTGTTGGATAGCGGATCTCAGATTGTCACGATGAGTAGAGAGGCTGCTAGTGAATGTAAGCTA
GCATGGGACCCATCTATGGCGATTAATATGCAAAGCGCTAATGGAGGGATCACCCGAACATGTGGGCTAGCTAAG
AATGTTCCCTTCCTCTTCGGAACAATCACGGCGTACCTACAGGTGCATGTTATCGAAGATGCACCTTATCGAGTA
CTACTAGGAAGACCGTTTGACGTTCTACTAGAAAGTAAGATAACGAACTCAGGAACAGGGCACCAGTTCATCACC
ATAACTGACCCGAATACAAAAGAATGGGCCTCGCTAGCTACTTATGCAAAAGGAGAGCTACCGAGGACATTGGAA
ACAAATTTTTAA
Gene >AgabiH97|086810
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAGACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTAGGAATGGCACCAAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCCACTGGTAACAACAATATTGTTGTTGATAGGGACCAAGAAGAAGAAGAACAGCTTGATTGGACCTACGCTAGT
CTTAACAAGCTAGGGACGGTACAAAAGATACAGACAGAAGCTAAGAATAAAGAAGGGAACCCAGTGAAAGTTTGG
GAAGTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGCCGAAAAGCGAGAGAGATTGGTGTTCACCATA
GAAAAAGAGGAGTCTCAGAGCGCCGAGACAATGGGGGAGTTACGCGTAATACCAGCAACCATTAATGGAGTCCGT
GAGGAAGAAGCGTTGTTGGATAGCGGATCTCAGATTGTCACGATGAGTAGAGAGGCTGCTAGTGAATGTAAGCTA
GCATGGGACCCATCTATGGCGATTAATATGCAAAGCGCTAATGGAGGGATCACCCGAACATGTGGGCTAGCTAAG
AATGTTCCCTTCCTCTTCGGAACAATCACGGCGTACCTACAGGTGCATGTTATCGAAGATGCACCTTATCGAGTA
CTACTAGGAAGACCGTTTGACGTTCTACTAGAAAGTAAGATAACGAACTCAGGAACAGGGCACCAGTTCATCACC
ATAACTGACCCGAATACAAAAGAATGGGCCTCGCTAGCTACTTATGCAAAAGGAGAGCTACCGAGGACATTGGAA
ACAAATTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail