Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|086730
Gene name
Locationscaffold_5:2111508..2113847
Strand+
Gene length (bp)2339
Transcript length (bp)2292
Coding sequence length (bp)2292
Protein length (aa) 764

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02992 Transposase_21 Transposase family tnp2 3.2E-26 386 565

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|086730
MGKSRKVICTCGCGRFVSHPTRRAHVAKVTKSAGERSADRVAGNKRQRSTSTESDVDQQMQNKRRCTTPIQDNIL
PSGDFEPLLSDDGNNDVVPSTPQSACVAERNMNALFQENPPPMATAGSRWEEESSDEDEQNSEAERHDSENEEEG
AIGNKDGEDEEEREDDGGSERESEGEGEGEDEEENEDRNGEHDGRNELHRLTMDEAGTSVWDGMDDERLRLIMAF
DEPLGTADIDLLRKYVFKVEDHLTEKSFARLAQVFPGSGHVSLKMTKKQVRLLSGFQSVRYSCCINSCVCFTGPY
EALTHCPHCHEPKLDARNNPRKFFDYIPLIPRLRAMSSNARNADLMRYRARFDHEPGVTKDVFDGSHYQSLLNKI
VPASNDSPFFYISDERDIALGLSTDGFAPFKRRDKTCWPIILFNYNLPPDIHFQKKYCINVGTIPGPKKPWDMDS
FLRPLIQELIQLEVGVKAFDAISQSIFLLHAYLILAFGDIPAMALIMRMKGSNGISPCRICNIVGVHNATSRTYY
VPLRRHSGQPLQYDPANLPIRVHDELMAQAKEVQNAPTKTVYDRLSKQYGIKGVPILATLTSISFPASFPFDFMH
LIWENLIPNLILFWTATFKELDHEDRGYVISPEAWKEVGEVAAACKATIPSAFGAPVPNVALQRSQMTSEMYSNW
TLFIAPIVLRGRFQRPIYYKHFLRLVQLLKMCLELEISSEVLDQIDEGFQAWVEDYERCVINYINPFVIQLVIDF
IMGISLTDFPHAR*
Coding >AgabiH97|086730
ATGGGTAAATCACGAAAAGTCATATGCACATGCGGTTGTGGTCGATTTGTTTCTCATCCAACAAGGCGAGCGCAC
GTGGCAAAAGTAACAAAATCAGCAGGAGAACGCTCAGCTGATCGTGTAGCTGGAAACAAGCGCCAGCGCTCAACT
TCAACAGAAAGCGATGTCGACCAGCAAATGCAAAACAAAAGAAGATGCACCACACCTATTCAAGACAATATATTA
CCCTCTGGTGACTTCGAGCCTCTACTGAGCGATGATGGCAACAATGATGTTGTCCCATCGACGCCTCAGTCAGCT
TGTGTAGCAGAACGGAACATGAATGCCCTTTTTCAGGAGAACCCTCCTCCCATGGCAACTGCAGGTTCTCGATGG
GAAGAAGAATCTAGCGACGAGGATGAACAAAATAGCGAGGCTGAAAGACATGACAGCGAAAACGAAGAAGAGGGT
GCTATAGGTAACAAGGACGGAGAGGACGAAGAAGAGCGAGAAGACGACGGCGGCAGTGAAAGAGAGAGTGAGGGT
GAGGGTGAGGGTGAGGACGAAGAAGAGAACGAAGACAGGAATGGTGAACATGACGGACGGAATGAGCTTCATCGC
CTCACTATGGATGAGGCTGGAACTTCTGTATGGGATGGGATGGATGACGAACGTCTCCGCTTGATCATGGCATTC
GATGAACCGTTGGGTACAGCTGATATCGATCTGCTTCGGAAATATGTCTTCAAGGTCGAGGACCATCTGACCGAG
AAGTCATTTGCGCGACTTGCGCAGGTCTTCCCTGGGTCTGGACATGTATCACTCAAAATGACGAAGAAACAAGTC
CGGTTGTTGTCAGGTTTCCAATCAGTTCGATACAGCTGTTGCATAAACAGCTGTGTCTGTTTCACTGGACCGTAC
GAAGCCCTCACCCACTGCCCTCACTGTCATGAGCCCAAGTTAGACGCTCGAAACAACCCCCGAAAATTCTTTGAC
TACATTCCTCTGATACCTCGCTTACGGGCTATGTCCTCCAATGCCCGAAATGCCGACCTCATGCGCTATCGAGCC
CGTTTCGATCATGAGCCTGGAGTCACAAAGGATGTATTTGATGGATCCCATTATCAGTCATTACTGAATAAGATT
GTTCCCGCCAGCAATGACTCTCCCTTTTTCTATATTTCGGATGAACGTGATATTGCCCTTGGTCTATCTACCGAC
GGTTTTGCTCCATTTAAGCGACGGGATAAAACATGTTGGCCAATCATATTATTCAACTACAACCTGCCCCCCGAT
ATACACTTTCAAAAAAAATATTGTATCAATGTTGGTACAATACCGGGCCCTAAAAAACCATGGGATATGGATTCC
TTCCTTCGGCCTCTCATTCAAGAGCTGATTCAGCTTGAGGTGGGAGTTAAAGCCTTCGACGCGATCAGCCAATCT
ATTTTTCTACTTCACGCCTATCTTATCCTTGCCTTCGGTGATATCCCTGCCATGGCGCTCATCATGCGCATGAAA
GGGTCCAACGGAATTAGTCCCTGCCGGATCTGTAATATCGTGGGTGTTCACAATGCTACTTCACGAACTTATTAT
GTCCCGCTACGACGACATAGTGGCCAACCACTCCAATATGATCCGGCAAATCTGCCTATTCGGGTACATGACGAG
CTGATGGCACAAGCCAAAGAGGTTCAGAATGCCCCGACTAAAACAGTATATGACCGGCTCTCCAAGCAATATGGA
ATAAAAGGTGTTCCCATCCTCGCGACTCTAACATCAATCTCTTTCCCTGCCTCGTTCCCCTTCGACTTTATGCAC
CTTATATGGGAAAACCTCATTCCCAACCTTATCTTATTCTGGACCGCCACTTTCAAGGAACTTGACCACGAAGAC
AGAGGCTATGTCATCTCGCCTGAAGCTTGGAAAGAAGTTGGAGAGGTTGCGGCTGCGTGCAAAGCAACCATCCCT
TCAGCATTTGGTGCACCCGTACCTAATGTTGCCTTGCAGCGCTCACAAATGACCTCCGAAATGTATTCAAACTGG
ACCCTCTTTATTGCTCCCATTGTATTGCGCGGACGGTTCCAACGACCAATATATTACAAACACTTCTTGAGACTC
GTCCAGCTGCTGAAAATGTGCTTGGAGCTCGAGATTAGTAGTGAAGTGTTAGATCAGATAGACGAAGGCTTTCAG
GCTTGGGTAGAGGACTATGAAAGGTGCGTCATCAACTACATCAATCCTTTTGTTATTCAACTTGTGATAGACTTT
ATTATGGGCATCAGCCTGACCGACTTTCCTCATGCCCGTTAA
Transcript >AgabiH97|086730
ATGGGTAAATCACGAAAAGTCATATGCACATGCGGTTGTGGTCGATTTGTTTCTCATCCAACAAGGCGAGCGCAC
GTGGCAAAAGTAACAAAATCAGCAGGAGAACGCTCAGCTGATCGTGTAGCTGGAAACAAGCGCCAGCGCTCAACT
TCAACAGAAAGCGATGTCGACCAGCAAATGCAAAACAAAAGAAGATGCACCACACCTATTCAAGACAATATATTA
CCCTCTGGTGACTTCGAGCCTCTACTGAGCGATGATGGCAACAATGATGTTGTCCCATCGACGCCTCAGTCAGCT
TGTGTAGCAGAACGGAACATGAATGCCCTTTTTCAGGAGAACCCTCCTCCCATGGCAACTGCAGGTTCTCGATGG
GAAGAAGAATCTAGCGACGAGGATGAACAAAATAGCGAGGCTGAAAGACATGACAGCGAAAACGAAGAAGAGGGT
GCTATAGGTAACAAGGACGGAGAGGACGAAGAAGAGCGAGAAGACGACGGCGGCAGTGAAAGAGAGAGTGAGGGT
GAGGGTGAGGGTGAGGACGAAGAAGAGAACGAAGACAGGAATGGTGAACATGACGGACGGAATGAGCTTCATCGC
CTCACTATGGATGAGGCTGGAACTTCTGTATGGGATGGGATGGATGACGAACGTCTCCGCTTGATCATGGCATTC
GATGAACCGTTGGGTACAGCTGATATCGATCTGCTTCGGAAATATGTCTTCAAGGTCGAGGACCATCTGACCGAG
AAGTCATTTGCGCGACTTGCGCAGGTCTTCCCTGGGTCTGGACATGTATCACTCAAAATGACGAAGAAACAAGTC
CGGTTGTTGTCAGGTTTCCAATCAGTTCGATACAGCTGTTGCATAAACAGCTGTGTCTGTTTCACTGGACCGTAC
GAAGCCCTCACCCACTGCCCTCACTGTCATGAGCCCAAGTTAGACGCTCGAAACAACCCCCGAAAATTCTTTGAC
TACATTCCTCTGATACCTCGCTTACGGGCTATGTCCTCCAATGCCCGAAATGCCGACCTCATGCGCTATCGAGCC
CGTTTCGATCATGAGCCTGGAGTCACAAAGGATGTATTTGATGGATCCCATTATCAGTCATTACTGAATAAGATT
GTTCCCGCCAGCAATGACTCTCCCTTTTTCTATATTTCGGATGAACGTGATATTGCCCTTGGTCTATCTACCGAC
GGTTTTGCTCCATTTAAGCGACGGGATAAAACATGTTGGCCAATCATATTATTCAACTACAACCTGCCCCCCGAT
ATACACTTTCAAAAAAAATATTGTATCAATGTTGGTACAATACCGGGCCCTAAAAAACCATGGGATATGGATTCC
TTCCTTCGGCCTCTCATTCAAGAGCTGATTCAGCTTGAGGTGGGAGTTAAAGCCTTCGACGCGATCAGCCAATCT
ATTTTTCTACTTCACGCCTATCTTATCCTTGCCTTCGGTGATATCCCTGCCATGGCGCTCATCATGCGCATGAAA
GGGTCCAACGGAATTAGTCCCTGCCGGATCTGTAATATCGTGGGTGTTCACAATGCTACTTCACGAACTTATTAT
GTCCCGCTACGACGACATAGTGGCCAACCACTCCAATATGATCCGGCAAATCTGCCTATTCGGGTACATGACGAG
CTGATGGCACAAGCCAAAGAGGTTCAGAATGCCCCGACTAAAACAGTATATGACCGGCTCTCCAAGCAATATGGA
ATAAAAGGTGTTCCCATCCTCGCGACTCTAACATCAATCTCTTTCCCTGCCTCGTTCCCCTTCGACTTTATGCAC
CTTATATGGGAAAACCTCATTCCCAACCTTATCTTATTCTGGACCGCCACTTTCAAGGAACTTGACCACGAAGAC
AGAGGCTATGTCATCTCGCCTGAAGCTTGGAAAGAAGTTGGAGAGGTTGCGGCTGCGTGCAAAGCAACCATCCCT
TCAGCATTTGGTGCACCCGTACCTAATGTTGCCTTGCAGCGCTCACAAATGACCTCCGAAATGTATTCAAACTGG
ACCCTCTTTATTGCTCCCATTGTATTGCGCGGACGGTTCCAACGACCAATATATTACAAACACTTCTTGAGACTC
GTCCAGCTGCTGAAAATGTGCTTGGAGCTCGAGATTAGTAGTGAAGTGTTAGATCAGATAGACGAAGGCTTTCAG
GCTTGGGTAGAGGACTATGAAAGGTGCGTCATCAACTACATCAATCCTTTTGTTATTCAACTTGTGATAGACTTT
ATTATGGGCATCAGCCTGACCGACTTTCCTCATGCCCGTTAA
Gene >AgabiH97|086730
ATGGGTAAATCACGAAAAGTCATATGCACATGCGGTTGTGGTCGATTTGTTTCTCATCCAACAAGGCGAGCGCAC
GTGGCAAAAGTAACAAAATCAGCAGGAGAACGCTCAGCTGATCGTGTAGCTGGAAACAAGCGCCAGCGCTCAACT
TCAACAGAAAGCGATGTCGACCAGCAAATGCAAAACAAAAGAAGATGCACCACACCTATTCAAGACAATATATTA
CCCTCTGGTGACTTCGAGCCTCTACTGAGCGATGATGGCAACAATGATGTTGTCCCATCGACGCCTCAGTCAGCT
TGTGTAGCAGAACGGAACATGAATGCCCTTTTTCAGGAGAACCCTCCTCCCATGGCAACTGCAGGTTCTCGATGG
GAAGAAGAATCTAGCGACGAGGATGAACAAAATAGCGAGGCTGAAAGACATGACAGCGAAAACGAAGAAGAGGGT
GCTATAGGTAACAAGGACGGAGAGGACGAAGAAGAGCGAGAAGACGACGGCGGCAGTGAAAGAGAGAGTGAGGGT
GAGGGTGAGGGTGAGGACGAAGAAGAGAACGAAGACAGGAATGGTGAACATGACGGACGGAATGAGCTTCATCGC
CTCACTATGGATGAGGCTGGAACTTCTGTATGGGATGGGATGGATGACGAACGTCTCCGCTTGATCATGGCATTC
GGTTGGTTTTTAGCTATTAGAGTGTTGAGTAGTGCTGATTCAATCTAGATGAACCGTTGGGTACAGCTGATATCG
ATCTGCTTCGGAAATATGTCTTCAAGGTCGAGGACCATCTGACCGAGAAGTCATTTGCGCGACTTGCGCAGGTCT
TCCCTGGGTCTGGACATGTATCACTCAAAATGACGAAGAAACAAGTCCGGTTGTTGTCAGGTTTCCAATCAGTTC
GATACAGCTGTTGCATAAACAGCTGTGTCTGTTTCACTGGACCGTACGAAGCCCTCACCCACTGCCCTCACTGTC
ATGAGCCCAAGTTAGACGCTCGAAACAACCCCCGAAAATTCTTTGACTACATTCCTCTGATACCTCGCTTACGGG
CTATGTCCTCCAATGCCCGAAATGCCGACCTCATGCGCTATCGAGCCCGTTTCGATCATGAGCCTGGAGTCACAA
AGGATGTATTTGATGGATCCCATTATCAGTCATTACTGAATAAGATTGTTCCCGCCAGCAATGACTCTCCCTTTT
TCTATATTTCGGATGAACGTGATATTGCCCTTGGTCTATCTACCGACGGTTTTGCTCCATTTAAGCGACGGGATA
AAACATGTTGGCCAATCATATTATTCAACTACAACCTGCCCCCCGATATACACTTTCAAAAAAAATATTGTATCA
ATGTTGGTACAATACCGGGCCCTAAAAAACCATGGGATATGGATTCCTTCCTTCGGCCTCTCATTCAAGAGCTGA
TTCAGCTTGAGGTGGGAGTTAAAGCCTTCGACGCGATCAGCCAATCTATTTTTCTACTTCACGCCTATCTTATCC
TTGCCTTCGGTGATATCCCTGCCATGGCGCTCATCATGCGCATGAAAGGGTCCAACGGAATTAGTCCCTGCCGGA
TCTGTAATATCGTGGGTGTTCACAATGCTACTTCACGAACTTATTATGTCCCGCTACGACGACATAGTGGCCAAC
CACTCCAATATGATCCGGCAAATCTGCCTATTCGGGTACATGACGAGCTGATGGCACAAGCCAAAGAGGTTCAGA
ATGCCCCGACTAAAACAGTATATGACCGGCTCTCCAAGCAATATGGAATAAAAGGTGTTCCCATCCTCGCGACTC
TAACATCAATCTCTTTCCCTGCCTCGTTCCCCTTCGACTTTATGCACCTTATATGGGAAAACCTCATTCCCAACC
TTATCTTATTCTGGACCGCCACTTTCAAGGAACTTGACCACGAAGACAGAGGCTATGTCATCTCGCCTGAAGCTT
GGAAAGAAGTTGGAGAGGTTGCGGCTGCGTGCAAAGCAACCATCCCTTCAGCATTTGGTGCACCCGTACCTAATG
TTGCCTTGCAGCGCTCACAAATGACCTCCGAAATGTATTCAAACTGGACCCTCTTTATTGCTCCCATTGTATTGC
GCGGACGGTTCCAACGACCAATATATTACAAACACTTCTTGAGACTCGTCCAGCTGCTGAAAATGTGCTTGGAGC
TCGAGATTAGTAGTGAAGTGTTAGATCAGATAGACGAAGGCTTTCAGGCTTGGGTAGAGGACTATGAAAGGTGCG
TCATCAACTACATCAATCCTTTTGTTATTCAACTTGTGATAGACTTTATTATGGGCATCAGCCTGACCGACTTTC
CTCATGCCCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail