Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|086480
Gene name
Locationscaffold_5:2051120..2053301
Strand+
Gene length (bp)2181
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-13 12 68
PF01266 DAO FAD dependent oxidoreductase 2.2E-07 9 48
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 8.8E-05 18 94

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 157 179 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|086480
MTAQLPRKRVLIVGGGATGMSAAYALSQHPDKFDVVLYERSAHPGGMATSVPIDKAKYGAEYINDGVQGASPVFY
NTYALFDRLGFKASDVGMQVSFGRDPETDFWTNVFPSPVIDEFSADIKKFGWVLKVIKALELVFAMISVSAMLRI
FRFSKRFGDVIVFPLVALFFGTGNQTPFISSAILERVFMDPNMRLFEYSSDTFLASIPRMCAFPHLSELYSAWKS
IVEEQGKGSTQIITCREVTRARRSSKGVYVWSCSTQGTDNSQSVVEPGREKKEFFDEIVFCCDADAALQILGNDA
TWLEKKILGNVKYLWDITVTHSDLPYMEKYYRVRYDPELRSKKGIENPQRQERYSFAEKHFEPLYFIRSVPEDKS
QIEMSFDLTVYQPQFNEASRSGSDSASGYQNEKGATSVVNDDSIPKHLPLERHVFQTIFLDHSPESRKFWTKGAI
NPDEVILEKWWKQQSHRWQHYAGTVPWMGLINGKNHTQFAGAWTVINMHEIAVVSGFGAAYRLGASYPFRDNQDC
KRLFALCLGVNHMMRMRREDRDGYLS*
Coding >AgabiH97|086480
ATGACTGCGCAACTACCTAGGAAACGCGTCCTCATCGTTGGCGGAGGAGCCACCGGAATGTCCGCCGCATACGCC
CTTTCCCAGCACCCGGATAAATTCGATGTCGTCCTCTACGAGCGCTCGGCTCATCCTGGAGGTATGGCCACTTCC
GTTCCCATAGATAAGGCAAAATACGGAGCAGAATATATCAACGATGGCGTTCAGGGTGCTAGCCCGGTGTTTTAC
AACACATATGCGCTCTTTGACCGGTTGGGTTTCAAGGCTTCCGATGTCGGTATGCAAGTTAGCTTTGGACGCGAT
CCTGAGACGGACTTTTGGACCAACGTATTTCCCAGCCCGGTTATAGACGAGTTCAGTGCTGACATCAAGAAGTTC
GGATGGGTCCTCAAAGTCATCAAAGCACTGGAGCTAGTTTTTGCTATGATTTCTGTCAGCGCCATGCTCAGGATC
TTTAGATTTTCAAAGAGATTTGGCGACGTCATCGTTTTTCCTCTAGTTGCGCTCTTCTTTGGCACTGGCAACCAG
ACCCCTTTTATCTCATCTGCTATCCTCGAACGTGTATTCATGGATCCCAATATGCGTTTGTTTGAATATTCGTCT
GACACCTTTCTGGCATCCATACCCCGCATGTGCGCATTTCCTCACTTATCAGAGCTTTACTCGGCTTGGAAATCC
ATTGTGGAAGAGCAGGGGAAAGGATCTACTCAAATCATCACTTGTCGAGAAGTTACTCGAGCTAGGAGAAGCAGC
AAAGGGGTCTATGTTTGGAGTTGTTCTACTCAAGGCACTGATAACTCGCAATCTGTCGTTGAGCCTGGGAGAGAA
AAGAAAGAGTTCTTTGACGAAATCGTGTTCTGTTGTGACGCCGATGCTGCTCTGCAGATACTCGGCAATGACGCC
ACCTGGTTGGAAAAGAAAATATTAGGCAATGTCAAGTATTTATGGGATATTACCGTTACCCACAGTGATCTCCCT
TATATGGAGAAGTACTATCGTGTTCGATATGATCCAGAGCTTCGTTCGAAGAAGGGTATCGAGAATCCACAACGT
CAAGAACGTTATTCATTTGCAGAGAAGCATTTTGAGCCACTTTATTTCATTCGAAGCGTACCTGAGGATAAAAGT
CAGATTGAAATGAGTTTTGATCTCACAGTGTACCAGCCGCAGTTTAACGAGGCATCACGCAGTGGTTCAGATTCA
GCAAGCGGATATCAGAATGAAAAAGGCGCTACCTCAGTCGTAAATGACGATTCCATACCCAAGCATCTTCCACTC
GAGCGACATGTTTTCCAAACTATCTTTCTCGATCATTCCCCCGAAAGTCGAAAGTTCTGGACTAAAGGTGCGATC
AATCCAGATGAAGTGATTTTGGAAAAGTGGTGGAAGCAACAAAGCCACCGATGGCAACATTATGCCGGAACCGTT
CCATGGATGGGCCTTATCAACGGGAAGAATCACACACAATTTGCCGGTGCTTGGACTGTAATAAATATGCACGAG
ATCGCTGTGGTCTCCGGTTTCGGTGCAGCTTATCGGTTGGGAGCATCGTACCCATTCAGAGACAATCAGGATTGC
AAACGGCTATTCGCTCTTTGCCTTGGGGTAAATCATATGATGCGCATGAGGCGAGAAGATAGAGATGGATACCTT
AGCTAA
Transcript >AgabiH97|086480
ATGACTGCGCAACTACCTAGGAAACGCGTCCTCATCGTTGGCGGAGGAGCCACCGGAATGTCCGCCGCATACGCC
CTTTCCCAGCACCCGGATAAATTCGATGTCGTCCTCTACGAGCGCTCGGCTCATCCTGGAGGTATGGCCACTTCC
GTTCCCATAGATAAGGCAAAATACGGAGCAGAATATATCAACGATGGCGTTCAGGGTGCTAGCCCGGTGTTTTAC
AACACATATGCGCTCTTTGACCGGTTGGGTTTCAAGGCTTCCGATGTCGGTATGCAAGTTAGCTTTGGACGCGAT
CCTGAGACGGACTTTTGGACCAACGTATTTCCCAGCCCGGTTATAGACGAGTTCAGTGCTGACATCAAGAAGTTC
GGATGGGTCCTCAAAGTCATCAAAGCACTGGAGCTAGTTTTTGCTATGATTTCTGTCAGCGCCATGCTCAGGATC
TTTAGATTTTCAAAGAGATTTGGCGACGTCATCGTTTTTCCTCTAGTTGCGCTCTTCTTTGGCACTGGCAACCAG
ACCCCTTTTATCTCATCTGCTATCCTCGAACGTGTATTCATGGATCCCAATATGCGTTTGTTTGAATATTCGTCT
GACACCTTTCTGGCATCCATACCCCGCATGTGCGCATTTCCTCACTTATCAGAGCTTTACTCGGCTTGGAAATCC
ATTGTGGAAGAGCAGGGGAAAGGATCTACTCAAATCATCACTTGTCGAGAAGTTACTCGAGCTAGGAGAAGCAGC
AAAGGGGTCTATGTTTGGAGTTGTTCTACTCAAGGCACTGATAACTCGCAATCTGTCGTTGAGCCTGGGAGAGAA
AAGAAAGAGTTCTTTGACGAAATCGTGTTCTGTTGTGACGCCGATGCTGCTCTGCAGATACTCGGCAATGACGCC
ACCTGGTTGGAAAAGAAAATATTAGGCAATGTCAAGTATTTATGGGATATTACCGTTACCCACAGTGATCTCCCT
TATATGGAGAAGTACTATCGTGTTCGATATGATCCAGAGCTTCGTTCGAAGAAGGGTATCGAGAATCCACAACGT
CAAGAACGTTATTCATTTGCAGAGAAGCATTTTGAGCCACTTTATTTCATTCGAAGCGTACCTGAGGATAAAAGT
CAGATTGAAATGAGTTTTGATCTCACAGTGTACCAGCCGCAGTTTAACGAGGCATCACGCAGTGGTTCAGATTCA
GCAAGCGGATATCAGAATGAAAAAGGCGCTACCTCAGTCGTAAATGACGATTCCATACCCAAGCATCTTCCACTC
GAGCGACATGTTTTCCAAACTATCTTTCTCGATCATTCCCCCGAAAGTCGAAAGTTCTGGACTAAAGGTGCGATC
AATCCAGATGAAGTGATTTTGGAAAAGTGGTGGAAGCAACAAAGCCACCGATGGCAACATTATGCCGGAACCGTT
CCATGGATGGGCCTTATCAACGGGAAGAATCACACACAATTTGCCGGTGCTTGGACTGTAATAAATATGCACGAG
ATCGCTGTGGTCTCCGGTTTCGGTGCAGCTTATCGGTTGGGAGCATCGTACCCATTCAGAGACAATCAGGATTGC
AAACGGCTATTCGCTCTTTGCCTTGGGGTAAATCATATGATGCGCATGAGGCGAGAAGATAGAGATGGATACCTT
AGCTAA
Gene >AgabiH97|086480
ATGACTGCGCAACTACCTAGGAAACGCGTCCTCATCGTTGGCGGAGGAGCCACCGGAATGTCCGCCGCATACGCC
CTTTCCCAGCACCCGGATAAATTCGATGTCGTCCTCTACGAGCGCTCGGCTCATCCTGGAGGTATGGCCACTTCC
GTTCCCATAGATAAGGCAAAATACGGAGCAGAATATATCAACGATGGCGTTCAGGGTGCTAGCCCGGTGTTTTAC
AACACATATGCGCTCTTTGACCGGTTGGGTTTCAAGGCTTCCGATGTCGGTATGCAAGTTAGCTTTGGACGCGAT
CCTGAGACGGACTTTTGGACCAACGTATTTCCCAGCCCGGTTATAGACGAGTAAGCACAGCCAGAAAGAAACGGG
ATACATGTTTATACGCATATATACAGGTTCAGTGCTGACATCAAGAAGTTCGGATGGGTCCTCAAAGTCATCAAA
GCACTGGAGCTAGTTTTTGCTATGATTTCTGTCAGCGCCATGCTCAGGATCTTTAGATTTTCAAAGGCTTGTCAT
ATTTGTCAAGGTGATATTGCTTCTCACTGACACACGAAAAGAGATTTGGCGACGTCATCGTTTTTCCTCTAGTTG
CGCTCTTCTTTGGCACTGGCAACCAGACCCCTTTTATCTCATCTGCTATCCTCGAACGTGTATTCATGGATCCCA
ATATGCGTTTGGTGAGACATCTCTTTAAAACGTTCGGTCAAAGGCTTAACCGAACATAGTTTGAATATTCGTCTG
ACACCTTTCTGGCATCCATACCCCGCATGTGCGCATTTCCTCACTTATCAGAGCTTTACTCGGCTTGGAAATCCA
TTGTGGAAGAGCAGGGGAAAGGATCTACTCAAATCATCACTTGTCGAGAAGTTACTCGAGCTAGGAGAAGCAGCA
AAGGGGTCTATGTTTGGAGTTGTTCTACTCAAGGCACTGATAACTCGCAATCTGTCGTTGAGCCTGGGAGAGAAA
AGAAAGAGTTCTTTGACGAAATCGTGTTCTGTTGTGACGCCGATGCTGCTCTGCAGATACTCGGCAATGACGCCA
CCTGGTTGGAAAAGAAAATATTAGGCAATGTCAAGGTCACCTCTGTTCGTTTTTGCGACAAGAGCTTGTTTACTG
ACTGGCCTTAGTATTTATGGGATATTACCGTTACCCACAGTGATCTCCCTTATATGGAGAAGGTGATATGACTTT
GTTGGATATGATGTTACGTACTGAAAATCTATCCAGTACTATCGTGTTCGATATGATCCAGAGCTTCGTTCGAAG
AAGGGTATCGAGAATCCACAACGTCAAGAACGTTATTCATTTGCAGAGAAGCATTTTGAGCCACTTTATTTCATT
CGAAGCGTACCTGAGGATAAAAGTCAGATTGAAATGAGTTTTGATCTCACAGTGTACCAGCCGCAGGCAAGTAAT
TTCCACCAAAATTAAACTCGAGTCTCATCTAATTGGCATAGTTTAACGAGGCATCACGCAGTGGTTCAGATTCAG
CAAGCGGATATCAGAATGAAAAAGGCGCTACCTCAGTCGTAAATGACGATTCCATACCCAAGCATCTTCCACTCG
AGCGACATGTTTTCCAAACTATCTTTCTCGATCATTCCCCCGAAAGTCGAAAGTTCTGGACTAAAGGTGCGATCA
ATCCAGATGAAGTGATTTTGGAAAAGTGGTGGAAGCAACAAAGCCACCGATGGCAACATTATGCCGGAACCGTTC
CATGGATGGGCCTTATCAACGGGAAGGTTAGTATTTCCCAGGTTCCCCTTGTCGAATATCGAAAAGTACTGACAA
TGTTTGCTCCGCAGAATCACACACAATTTGCCGGTGCTTGGACTGTAATAAGTGAGTTTATATTTCTAGCTTGCG
ACTTTATTGTTCTGAATCACCACCTCCTTAGATATGCACGAGATCGCTGTGGTCTCCGGTTTCGGTGCAGCTTAT
CGGTTGGGAGCATCGTACGTGGTTTTTCGCAATTTCAGCATAGCGCCCCAGATTTAACTCGATGCTCCAGGTACC
CATTCAGAGACAATCAGGATTGCAAACGGCTATTCGCTCTTTGCCTTGGGGTAAATCATATGATGCGCATGGTAT
GTGAAAATATGATCCATCTCGTTCAAGGCATTTAAACCTATTTGATAGAGGCGAGAAGATAGAGATGGATACCTT
AGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail