Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|086360
Gene name
Locationscaffold_5:2021228..2023207
Strand+
Gene length (bp)1979
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 2.0E-36 10 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VH78|ALG12_DROME Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster GN=CG8412 PE=2 SV=1 5 467 5.0E-69
sp|A8MR93|ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana GN=ALG12 PE=1 SV=1 16 468 2.0E-66
sp|Q8VDB2|ALG12_MOUSE Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus GN=Alg12 PE=2 SV=2 16 475 3.0E-65
sp|Q23361|ALG12_CAEEL Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans GN=ZC513.5 PE=1 SV=2 19 456 1.0E-64
sp|P53730|ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG12 PE=1 SV=1 3 488 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VH78|ALG12_DROME Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster GN=CG8412 PE=2 SV=1 5 467 5.0E-69
sp|A8MR93|ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana GN=ALG12 PE=1 SV=1 16 468 2.0E-66
sp|Q8VDB2|ALG12_MOUSE Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus GN=Alg12 PE=2 SV=2 16 475 3.0E-65
sp|Q23361|ALG12_CAEEL Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans GN=ZC513.5 PE=1 SV=2 19 456 1.0E-64
sp|P53730|ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG12 PE=1 SV=1 3 488 2.0E-61
sp|Q9BV10|ALG12_HUMAN Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens GN=ALG12 PE=1 SV=1 11 470 5.0E-60
sp|Q9USD4|ALG12_SCHPO Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg12 PE=3 SV=2 16 509 8.0E-52
sp|Q1LZA0|PIGB_BOVIN GPI mannosyltransferase 3 OS=Bos taurus GN=PIGB PE=2 SV=1 95 346 2.0E-07
sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN=pigb PE=2 SV=1 174 346 2.0E-07
sp|Q9JJQ0|PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus GN=Pigb PE=2 SV=2 99 411 2.0E-07
sp|Q4V7R2|PIGB_XENLA GPI mannosyltransferase 3 OS=Xenopus laevis GN=pigb PE=2 SV=1 143 328 2.0E-07
sp|Q92521|PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens GN=PIGB PE=2 SV=1 69 404 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 94 111 17
3 139 161 22
4 182 204 22
5 214 236 22
6 288 310 22
7 320 342 22
8 349 371 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 68.49 41.20 95.78
Initials Initials knots 57.68 34.55 80.81
Pileal_Stipeal_center Stage I stipe center 78.78 47.52 110.03
Pileal_Stipeal_shell Stage I stipe shell 79.34 47.89 110.79
DIF_stipe_center Stage II stipe center 80.01 48.19 111.83
DIF_stipe_shell Stage II stipe shell 77.07 46.35 107.79
DIF_stipe_skin Stage II stipe skin 77.21 46.51 107.91
DIF_cap_skin Stage II cap skin 87.02 52.47 121.58
DIF_cap_tissue Stage II cap tissue 87.43 52.52 122.34
DIF_gill_tissue Stage II gill tissue 83.16 50.11 116.20
YFB_stipe_center Young fruiting body stipe center 67.07 40.42 93.73
YFB_stipe_shell Young fruiting body stipe shell 75.54 45.55 105.53
YFB_stipe_skin Young fruiting body stipe skin 79.60 47.93 111.26
YFB_cap_skin Young fruiting body cap skin 90.55 54.65 126.44
YFB_cap_tissue Young fruiting body cap tissue 84.06 50.76 117.35
YFB_gill_tissue Young fruiting body gill tissue 85.25 51.18 119.33
YFB_veil Young fruiting body veil 85.82 51.51 120.14

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.602250 no
Casing YFB_stipe_center 0.968979 no
Casing YFB_stipe_shell 0.832717 no
Casing YFB_stipe_skin 0.715110 no
Casing YFB_cap_skin 0.391191 no
Casing YFB_cap_tissue 0.577536 no
Casing YFB_gill_tissue 0.536250 no
Casing YFB_veil 0.526472 no
Casing Initials 0.657272 no
Casing Pileal_Stipeal_center 0.737527 no
Casing Pileal_Stipeal_shell 0.724154 no
Casing DIF_stipe_center 0.699150 no
Casing DIF_stipe_shell 0.788689 no
Casing DIF_stipe_skin 0.784495 no
Casing DIF_cap_skin 0.490229 no
Casing DIF_cap_tissue 0.479328 no
DIF_gill_tissue YFB_stipe_center 0.540966 no
DIF_gill_tissue YFB_stipe_shell 0.835415 no
DIF_gill_tissue YFB_stipe_skin 0.935080 no
DIF_gill_tissue YFB_cap_skin 0.856005 no
DIF_gill_tissue YFB_cap_tissue 0.983452 no
DIF_gill_tissue YFB_gill_tissue 0.963578 no
DIF_gill_tissue YFB_veil 0.952907 no
YFB_stipe_center YFB_stipe_shell 0.782113 no
YFB_stipe_center YFB_stipe_skin 0.660458 no
YFB_stipe_center YFB_cap_skin 0.336860 no
YFB_stipe_center YFB_cap_tissue 0.514895 no
YFB_stipe_center YFB_gill_tissue 0.473948 no
YFB_stipe_center YFB_veil 0.465778 no
YFB_stipe_shell YFB_stipe_skin 0.918848 no
YFB_stipe_shell YFB_cap_skin 0.627081 no
YFB_stipe_shell YFB_cap_tissue 0.809347 no
YFB_stipe_shell YFB_gill_tissue 0.772091 no
YFB_stipe_shell YFB_veil 0.759791 no
YFB_stipe_skin YFB_cap_skin 0.764874 no
YFB_stipe_skin YFB_cap_tissue 0.915555 no
YFB_stipe_skin YFB_gill_tissue 0.888795 no
YFB_stipe_skin YFB_veil 0.876733 no
YFB_cap_skin YFB_cap_tissue 0.878491 no
YFB_cap_skin YFB_gill_tissue 0.903836 no
YFB_cap_skin YFB_veil 0.916208 no
YFB_cap_tissue YFB_gill_tissue 0.979465 no
YFB_cap_tissue YFB_veil 0.968777 no
YFB_gill_tissue YFB_veil 0.989255 no
Initials DIF_gill_tissue 0.207399 no
Initials YFB_stipe_center 0.707131 no
Initials YFB_stipe_shell 0.415808 no
Initials YFB_stipe_skin 0.300880 no
Initials YFB_cap_skin 0.096131 no
Initials YFB_cap_tissue 0.194728 no
Initials YFB_gill_tissue 0.173467 no
Initials YFB_veil 0.165288 no
Initials Pileal_Stipeal_center 0.315595 no
Initials Pileal_Stipeal_shell 0.299743 no
Initials DIF_stipe_center 0.286603 no
Initials DIF_stipe_shell 0.370584 no
Initials DIF_stipe_skin 0.365009 no
Initials DIF_cap_skin 0.142789 no
Initials DIF_cap_tissue 0.141946 no
Pileal_Stipeal_center DIF_gill_tissue 0.915681 no
Pileal_Stipeal_center YFB_stipe_center 0.683309 no
Pileal_Stipeal_center YFB_stipe_shell 0.937154 no
Pileal_Stipeal_center YFB_stipe_skin 0.984848 no
Pileal_Stipeal_center YFB_cap_skin 0.737672 no
Pileal_Stipeal_center YFB_cap_tissue 0.896879 no
Pileal_Stipeal_center YFB_gill_tissue 0.868386 no
Pileal_Stipeal_center YFB_veil 0.856086 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.988880 no
Pileal_Stipeal_center DIF_stipe_center 0.978747 no
Pileal_Stipeal_center DIF_stipe_shell 0.968595 no
Pileal_Stipeal_center DIF_stipe_skin 0.971555 no
Pileal_Stipeal_center DIF_cap_skin 0.828473 no
Pileal_Stipeal_center DIF_cap_tissue 0.818001 no
Pileal_Stipeal_shell DIF_gill_tissue 0.927060 no
Pileal_Stipeal_shell YFB_stipe_center 0.661387 no
Pileal_Stipeal_shell YFB_stipe_shell 0.924260 no
Pileal_Stipeal_shell YFB_stipe_skin 0.994203 no
Pileal_Stipeal_shell YFB_cap_skin 0.751126 no
Pileal_Stipeal_shell YFB_cap_tissue 0.909230 no
Pileal_Stipeal_shell YFB_gill_tissue 0.881180 no
Pileal_Stipeal_shell YFB_veil 0.868986 no
Pileal_Stipeal_shell DIF_stipe_center 0.987837 no
Pileal_Stipeal_shell DIF_stipe_shell 0.957195 no
Pileal_Stipeal_shell DIF_stipe_skin 0.959839 no
Pileal_Stipeal_shell DIF_cap_skin 0.842317 no
Pileal_Stipeal_shell DIF_cap_tissue 0.831060 no
DIF_stipe_center DIF_gill_tissue 0.941542 no
DIF_stipe_center YFB_stipe_center 0.643728 no
DIF_stipe_center YFB_stipe_shell 0.910574 no
DIF_stipe_center YFB_stipe_skin 0.991249 no
DIF_stipe_center YFB_cap_skin 0.774311 no
DIF_stipe_center YFB_cap_tissue 0.924724 no
DIF_stipe_center YFB_gill_tissue 0.898801 no
DIF_stipe_center YFB_veil 0.886776 no
DIF_stipe_center DIF_stipe_shell 0.944281 no
DIF_stipe_center DIF_stipe_skin 0.947261 no
DIF_stipe_center DIF_cap_skin 0.860829 no
DIF_stipe_center DIF_cap_tissue 0.850704 no
DIF_stipe_shell DIF_gill_tissue 0.872557 no
DIF_stipe_shell YFB_stipe_center 0.735027 no
DIF_stipe_shell YFB_stipe_shell 0.970772 no
DIF_stipe_shell YFB_stipe_skin 0.952018 no
DIF_stipe_shell YFB_cap_skin 0.680633 no
DIF_stipe_shell YFB_cap_tissue 0.852936 no
DIF_stipe_shell YFB_gill_tissue 0.820007 no
DIF_stipe_shell YFB_veil 0.808426 no
DIF_stipe_shell DIF_stipe_skin 0.996774 no
DIF_stipe_shell DIF_cap_skin 0.775336 no
DIF_stipe_shell DIF_cap_tissue 0.764728 no
DIF_stipe_skin DIF_gill_tissue 0.878139 no
DIF_stipe_skin YFB_stipe_center 0.732621 no
DIF_stipe_skin YFB_stipe_shell 0.969078 no
DIF_stipe_skin YFB_stipe_skin 0.956407 no
DIF_stipe_skin YFB_cap_skin 0.688376 no
DIF_stipe_skin YFB_cap_tissue 0.858179 no
DIF_stipe_skin YFB_gill_tissue 0.825027 no
DIF_stipe_skin YFB_veil 0.813613 no
DIF_stipe_skin DIF_cap_skin 0.781755 no
DIF_stipe_skin DIF_cap_tissue 0.772091 no
DIF_cap_skin DIF_gill_tissue 0.928923 no
DIF_cap_skin YFB_stipe_center 0.427860 no
DIF_cap_skin YFB_stipe_shell 0.730311 no
DIF_cap_skin YFB_stipe_skin 0.849148 no
DIF_cap_skin YFB_cap_skin 0.938099 no
DIF_cap_skin YFB_cap_tissue 0.946502 no
DIF_cap_skin YFB_gill_tissue 0.969592 no
DIF_cap_skin YFB_veil 0.979076 no
DIF_cap_skin DIF_cap_tissue 0.992507 no
DIF_cap_tissue DIF_gill_tissue 0.921916 no
DIF_cap_tissue YFB_stipe_center 0.418823 no
DIF_cap_tissue YFB_stipe_shell 0.720282 no
DIF_cap_tissue YFB_stipe_skin 0.839101 no
DIF_cap_tissue YFB_cap_skin 0.946397 no
DIF_cap_tissue YFB_cap_tissue 0.940416 no
DIF_cap_tissue YFB_gill_tissue 0.962704 no
DIF_cap_tissue YFB_veil 0.971198 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|086360
MISLLDVGFFALSWAYVLLAPYTKVEESFNIQAVHDFLSYGLLPDDLSHFDHFTFSGAVPRTFLGSAVLASTANP
FIIIAAYLNLISSKADLQLIVRLVLATCNAISLVVIRKAVSNRFGSGTASCFTLLTCSQFHLLFWMGRTLPNMFA
MPLINLAFAYASMYNSSRYSIRLSEKSWKLAFWCLAFSTVVLRVELVLLWVPFLLQALVQGRISFYTIISTNLLA
GITAAVASFIFDSFFWQKDVLPELTSFIFNVAQGQSSNWGVSPFLDYFKIHLPKLLMTGLPLAFVGLLTDSRIIP
ILFPFIIYTALISNLGHKEWRFIIYTVPAFNVAAASGLRYLFTRRKTTIFGPISFITALGFLAANFGLTGLLVHI
SMHNYPGGEAVAAFHQLVPATTLPPPHVHICNLAAQSGTTLFQHLNSPPYHSALYLWPNSVPPTTPWIYNKTENL
TLSELSRSPHFTHIISEQPPTSPEIAGHWNLMKAIPAFDRVVLDKELLTHKRWELPRRIFDLIRIVEKDQLWIYE
RK*
Coding >AgabiH97|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCTTGTCGTACGGCCTGTTGCCCGATGATTTGAGCCATTTT
GACCATTTCACTTTCTCAGGCGCTGTTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCA
TTCATCATTATAGCCGCATACCTCAATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGTTCGACTTGTTCTT
GCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTCAAATCGTTTCGGGTCAGGGACTGCTTCA
TGCTTCACTTTGCTCACATGTAGCCAATTCCACCTCCTTTTTTGGATGGGTAGAACGCTGCCAAATATGTTTGCT
ATGCCATTGATCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCAGCCGCTATTCGATCCGGCTTTCCGAG
AAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTACTCCGCGTGGAGTTAGTTCTTCTCTGG
GTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATACCATTATCTCGACGAATCTCCTAGCT
GGCATCACAGCTGCAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTAACA
TCATTCATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTTTCCCCCTTCTTGGACTACTTCAAGATT
CATCTCCCTAAATTGCTCATGACCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCGCGAATCATCCCG
ATTCTCTTTCCCTTCATCATTTATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTAC
ACGGTACCCGCCTTCAATGTCGCCGCCGCTTCCGGTTTAAGATACCTGTTCACGAGGCGCAAAACGACCATATTT
GGCCCAATCTCGTTTATAACTGCCCTGGGCTTTCTGGCGGCGAACTTTGGATTGACCGGTCTTCTCGTCCATATA
TCCATGCACAATTATCCAGGCGGTGAGGCTGTTGCTGCTTTCCATCAACTCGTTCCTGCCACCACGTTGCCTCCA
CCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTCTTTTCCAACACCTCAATTCTCCGCCCTAC
CATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACCCCCTGGATTTATAACAAAACTGAGAATCTC
ACACTATCCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCTCTGAACAGCCTCCCACCAGCCCAGAAATC
GCTGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCGTTGTGTTAGACAAGGAATTGCTGACCCAT
AAACGTTGGGAGTTGCCCCGAAGAATCTTTGATTTGATCAGAATTGTTGAGAAGGACCAGTTGTGGATATATGAA
CGCAAATAG
Transcript >AgabiH97|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCTTGTCGTACGGCCTGTTGCCCGATGATTTGAGCCATTTT
GACCATTTCACTTTCTCAGGCGCTGTTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCA
TTCATCATTATAGCCGCATACCTCAATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGTTCGACTTGTTCTT
GCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTCAAATCGTTTCGGGTCAGGGACTGCTTCA
TGCTTCACTTTGCTCACATGTAGCCAATTCCACCTCCTTTTTTGGATGGGTAGAACGCTGCCAAATATGTTTGCT
ATGCCATTGATCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCAGCCGCTATTCGATCCGGCTTTCCGAG
AAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTACTCCGCGTGGAGTTAGTTCTTCTCTGG
GTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATACCATTATCTCGACGAATCTCCTAGCT
GGCATCACAGCTGCAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTAACA
TCATTCATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTTTCCCCCTTCTTGGACTACTTCAAGATT
CATCTCCCTAAATTGCTCATGACCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCGCGAATCATCCCG
ATTCTCTTTCCCTTCATCATTTATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTAC
ACGGTACCCGCCTTCAATGTCGCCGCCGCTTCCGGTTTAAGATACCTGTTCACGAGGCGCAAAACGACCATATTT
GGCCCAATCTCGTTTATAACTGCCCTGGGCTTTCTGGCGGCGAACTTTGGATTGACCGGTCTTCTCGTCCATATA
TCCATGCACAATTATCCAGGCGGTGAGGCTGTTGCTGCTTTCCATCAACTCGTTCCTGCCACCACGTTGCCTCCA
CCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTCTTTTCCAACACCTCAATTCTCCGCCCTAC
CATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACCCCCTGGATTTATAACAAAACTGAGAATCTC
ACACTATCCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCTCTGAACAGCCTCCCACCAGCCCAGAAATC
GCTGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCGTTGTGTTAGACAAGGAATTGCTGACCCAT
AAACGTTGGGAGTTGCCCCGAAGAATCTTTGATTTGATCAGAATTGTTGAGAAGGACCAGTTGTGGATATATGAA
CGCAAATAG
Gene >AgabiH97|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCTTGTCGTACGGCCTGTTGCCCGATGATTTGAGCCATGTG
AGCCCAACGCCACGCATTAAACTTGAACAATGCTCATCTGCAAGCAGTTTGACCATTTCACTTTCTCAGGCGCTG
TTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCATTCATCATTATAGCCGCATACCTCA
ATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGGTTCGATTTTTGTTATTTTTGTAAAAGTCCCTTTTCCTG
AGCAGCTTTTACAGTTCGACTTGTTCTTGCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTC
AAATCGTTTCGGGTCAGGGACTGCTTCATGCTTCACTTTGCTCACATGTAGCCAATTCCACCTCCTTTTTTGGAT
GGGTAGAACGCTGCCAAATATGTTTGCTATGCCATTGAGTATGTTTCTATTCATTCTTTCCTTGGAACAATCTAA
CGTAATTTTTGTATTTGACATTGCGCAGTCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCAGCCGCTAT
TCGATCCGGCTTTCCGAGAAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTACTCCGCGTG
GAGTTAGTTCTTCTCTGGGTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATACCATTATC
TCGACGAATCTCCTAGCTGGCATCACAGCTGCAGGTAAGCCCGCGAAACTCCACTGACGTATCGATGACTGAGCA
GTTGCATCTAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTAACATCATT
CATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTGAGTCCTTGAACATCATATAATCCGGACTCGAC
CTGCTGACCTTTGCACGAAACAGGTTTCCCCCTTCTTGGACTACTTCAAGATTCATCTCCCTAAATTGCTCATGA
CCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCGCGAATCATCCCGATTCTCTTTCCCTTCATCATTT
ATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTACACGGTACCCGCCTTCAATGTCG
CCGCCGCTTCCGGTTTAAGATACCTGTACGTTACTGGTTCCTAATTTCCGAATGATGCTCCTGAATAACCCGACC
TTCCTCCCCAGGTTCACGAGGCGCAAAACGACCATATTTGGCCCAATCTCGTTTATAACTGCCCTGGGCTTTCTG
GCGGCGAACTTTGGATTGACCGGTCTTCTCGTCCATATATCCATGCACAATTATCCAGGCGGTGAGGCTGTTGCT
GCTTTCCATCAACTCGTTCCTGCCACCACGTTGCGTAAGTTGATTTTTGTATTATTAAATTCCATTCTCATTCCA
TCACAATAATGATAGCTCCACCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTCTTTTCCAAC
ACCTCAATTCTCCGCCCTACCATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACCCCCTGGATTT
ATAACAAAACTGAGAATCTCACACTATCCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCTCTGAACAGC
CTCCCACCAGCCCAGAAATCGCTGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCGTTGTGTTAG
ACAAGGAATTGCTGACCCATAAACGTTGGGAGTTGCCCCGAAGAATCTTTGATTTGATCAGAATTGTTGAGAAGG
ACCAGTTGTGGATATATGAACGCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail