Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|086360
Gene name
Locationscaffold_5:2021228..2023207
Strand+
Gene length (bp)1979
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 2.0E-36 10 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VH78|ALG12_DROME Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster GN=CG8412 PE=2 SV=1 5 467 5.0E-69
sp|A8MR93|ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana GN=ALG12 PE=1 SV=1 16 468 2.0E-66
sp|Q8VDB2|ALG12_MOUSE Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus GN=Alg12 PE=2 SV=2 16 475 3.0E-65
sp|Q23361|ALG12_CAEEL Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans GN=ZC513.5 PE=1 SV=2 19 456 1.0E-64
sp|P53730|ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG12 PE=1 SV=1 3 488 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VH78|ALG12_DROME Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster GN=CG8412 PE=2 SV=1 5 467 5.0E-69
sp|A8MR93|ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana GN=ALG12 PE=1 SV=1 16 468 2.0E-66
sp|Q8VDB2|ALG12_MOUSE Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus GN=Alg12 PE=2 SV=2 16 475 3.0E-65
sp|Q23361|ALG12_CAEEL Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans GN=ZC513.5 PE=1 SV=2 19 456 1.0E-64
sp|P53730|ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG12 PE=1 SV=1 3 488 2.0E-61
sp|Q9BV10|ALG12_HUMAN Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens GN=ALG12 PE=1 SV=1 11 470 5.0E-60
sp|Q9USD4|ALG12_SCHPO Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg12 PE=3 SV=2 16 509 8.0E-52
sp|Q1LZA0|PIGB_BOVIN GPI mannosyltransferase 3 OS=Bos taurus GN=PIGB PE=2 SV=1 95 346 2.0E-07
sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN=pigb PE=2 SV=1 174 346 2.0E-07
sp|Q9JJQ0|PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus GN=Pigb PE=2 SV=2 99 411 2.0E-07
sp|Q4V7R2|PIGB_XENLA GPI mannosyltransferase 3 OS=Xenopus laevis GN=pigb PE=2 SV=1 143 328 2.0E-07
sp|Q92521|PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens GN=PIGB PE=2 SV=1 69 404 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 94 111 17
3 139 161 22
4 182 204 22
5 214 236 22
6 288 310 22
7 320 342 22
8 349 371 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|086360
MISLLDVGFFALSWAYVLLAPYTKVEESFNIQAVHDFLSYGLLPDDLSHFDHFTFSGAVPRTFLGSAVLASTANP
FIIIAAYLNLISSKADLQLIVRLVLATCNAISLVVIRKAVSNRFGSGTASCFTLLTCSQFHLLFWMGRTLPNMFA
MPLINLAFAYASMYNSSRYSIRLSEKSWKLAFWCLAFSTVVLRVELVLLWVPFLLQALVQGRISFYTIISTNLLA
GITAAVASFIFDSFFWQKDVLPELTSFIFNVAQGQSSNWGVSPFLDYFKIHLPKLLMTGLPLAFVGLLTDSRIIP
ILFPFIIYTALISNLGHKEWRFIIYTVPAFNVAAASGLRYLFTRRKTTIFGPISFITALGFLAANFGLTGLLVHI
SMHNYPGGEAVAAFHQLVPATTLPPPHVHICNLAAQSGTTLFQHLNSPPYHSALYLWPNSVPPTTPWIYNKTENL
TLSELSRSPHFTHIISEQPPTSPEIAGHWNLMKAIPAFDRVVLDKELLTHKRWELPRRIFDLIRIVEKDQLWIYE
RK*
Coding >AgabiH97|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCTTGTCGTACGGCCTGTTGCCCGATGATTTGAGCCATTTT
GACCATTTCACTTTCTCAGGCGCTGTTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCA
TTCATCATTATAGCCGCATACCTCAATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGTTCGACTTGTTCTT
GCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTCAAATCGTTTCGGGTCAGGGACTGCTTCA
TGCTTCACTTTGCTCACATGTAGCCAATTCCACCTCCTTTTTTGGATGGGTAGAACGCTGCCAAATATGTTTGCT
ATGCCATTGATCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCAGCCGCTATTCGATCCGGCTTTCCGAG
AAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTACTCCGCGTGGAGTTAGTTCTTCTCTGG
GTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATACCATTATCTCGACGAATCTCCTAGCT
GGCATCACAGCTGCAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTAACA
TCATTCATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTTTCCCCCTTCTTGGACTACTTCAAGATT
CATCTCCCTAAATTGCTCATGACCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCGCGAATCATCCCG
ATTCTCTTTCCCTTCATCATTTATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTAC
ACGGTACCCGCCTTCAATGTCGCCGCCGCTTCCGGTTTAAGATACCTGTTCACGAGGCGCAAAACGACCATATTT
GGCCCAATCTCGTTTATAACTGCCCTGGGCTTTCTGGCGGCGAACTTTGGATTGACCGGTCTTCTCGTCCATATA
TCCATGCACAATTATCCAGGCGGTGAGGCTGTTGCTGCTTTCCATCAACTCGTTCCTGCCACCACGTTGCCTCCA
CCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTCTTTTCCAACACCTCAATTCTCCGCCCTAC
CATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACCCCCTGGATTTATAACAAAACTGAGAATCTC
ACACTATCCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCTCTGAACAGCCTCCCACCAGCCCAGAAATC
GCTGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCGTTGTGTTAGACAAGGAATTGCTGACCCAT
AAACGTTGGGAGTTGCCCCGAAGAATCTTTGATTTGATCAGAATTGTTGAGAAGGACCAGTTGTGGATATATGAA
CGCAAATAG
Transcript >AgabiH97|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCTTGTCGTACGGCCTGTTGCCCGATGATTTGAGCCATTTT
GACCATTTCACTTTCTCAGGCGCTGTTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCA
TTCATCATTATAGCCGCATACCTCAATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGTTCGACTTGTTCTT
GCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTCAAATCGTTTCGGGTCAGGGACTGCTTCA
TGCTTCACTTTGCTCACATGTAGCCAATTCCACCTCCTTTTTTGGATGGGTAGAACGCTGCCAAATATGTTTGCT
ATGCCATTGATCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCAGCCGCTATTCGATCCGGCTTTCCGAG
AAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTACTCCGCGTGGAGTTAGTTCTTCTCTGG
GTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATACCATTATCTCGACGAATCTCCTAGCT
GGCATCACAGCTGCAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTAACA
TCATTCATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTTTCCCCCTTCTTGGACTACTTCAAGATT
CATCTCCCTAAATTGCTCATGACCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCGCGAATCATCCCG
ATTCTCTTTCCCTTCATCATTTATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTAC
ACGGTACCCGCCTTCAATGTCGCCGCCGCTTCCGGTTTAAGATACCTGTTCACGAGGCGCAAAACGACCATATTT
GGCCCAATCTCGTTTATAACTGCCCTGGGCTTTCTGGCGGCGAACTTTGGATTGACCGGTCTTCTCGTCCATATA
TCCATGCACAATTATCCAGGCGGTGAGGCTGTTGCTGCTTTCCATCAACTCGTTCCTGCCACCACGTTGCCTCCA
CCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTCTTTTCCAACACCTCAATTCTCCGCCCTAC
CATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACCCCCTGGATTTATAACAAAACTGAGAATCTC
ACACTATCCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCTCTGAACAGCCTCCCACCAGCCCAGAAATC
GCTGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCGTTGTGTTAGACAAGGAATTGCTGACCCAT
AAACGTTGGGAGTTGCCCCGAAGAATCTTTGATTTGATCAGAATTGTTGAGAAGGACCAGTTGTGGATATATGAA
CGCAAATAG
Gene >AgabiH97|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCTTGTCGTACGGCCTGTTGCCCGATGATTTGAGCCATGTG
AGCCCAACGCCACGCATTAAACTTGAACAATGCTCATCTGCAAGCAGTTTGACCATTTCACTTTCTCAGGCGCTG
TTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCATTCATCATTATAGCCGCATACCTCA
ATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGGTTCGATTTTTGTTATTTTTGTAAAAGTCCCTTTTCCTG
AGCAGCTTTTACAGTTCGACTTGTTCTTGCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTC
AAATCGTTTCGGGTCAGGGACTGCTTCATGCTTCACTTTGCTCACATGTAGCCAATTCCACCTCCTTTTTTGGAT
GGGTAGAACGCTGCCAAATATGTTTGCTATGCCATTGAGTATGTTTCTATTCATTCTTTCCTTGGAACAATCTAA
CGTAATTTTTGTATTTGACATTGCGCAGTCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCAGCCGCTAT
TCGATCCGGCTTTCCGAGAAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTACTCCGCGTG
GAGTTAGTTCTTCTCTGGGTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATACCATTATC
TCGACGAATCTCCTAGCTGGCATCACAGCTGCAGGTAAGCCCGCGAAACTCCACTGACGTATCGATGACTGAGCA
GTTGCATCTAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTAACATCATT
CATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTGAGTCCTTGAACATCATATAATCCGGACTCGAC
CTGCTGACCTTTGCACGAAACAGGTTTCCCCCTTCTTGGACTACTTCAAGATTCATCTCCCTAAATTGCTCATGA
CCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCGCGAATCATCCCGATTCTCTTTCCCTTCATCATTT
ATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTACACGGTACCCGCCTTCAATGTCG
CCGCCGCTTCCGGTTTAAGATACCTGTACGTTACTGGTTCCTAATTTCCGAATGATGCTCCTGAATAACCCGACC
TTCCTCCCCAGGTTCACGAGGCGCAAAACGACCATATTTGGCCCAATCTCGTTTATAACTGCCCTGGGCTTTCTG
GCGGCGAACTTTGGATTGACCGGTCTTCTCGTCCATATATCCATGCACAATTATCCAGGCGGTGAGGCTGTTGCT
GCTTTCCATCAACTCGTTCCTGCCACCACGTTGCGTAAGTTGATTTTTGTATTATTAAATTCCATTCTCATTCCA
TCACAATAATGATAGCTCCACCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTCTTTTCCAAC
ACCTCAATTCTCCGCCCTACCATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACCCCCTGGATTT
ATAACAAAACTGAGAATCTCACACTATCCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCTCTGAACAGC
CTCCCACCAGCCCAGAAATCGCTGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCGTTGTGTTAG
ACAAGGAATTGCTGACCCATAAACGTTGGGAGTTGCCCCGAAGAATCTTTGATTTGATCAGAATTGTTGAGAAGG
ACCAGTTGTGGATATATGAACGCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail