Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|086350
Gene name
Locationscaffold_5:2017023..2021126
Strand-
Gene length (bp)4103
Transcript length (bp)3216
Coding sequence length (bp)3216
Protein length (aa) 1072

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 5.7E-36 797 1008
PF00005 ABC_tran ABC transporter 2.9E-27 403 554
PF19055 ABC2_membrane_7 ABC-2 type transporter 2.0E-06 584 639
PF19055 ABC2_membrane_7 ABC-2 type transporter 1.3E-06 784 1006
PF07974 EGF_2 EGF-like domain 1.4E-05 71 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 21 1071 0.0E+00
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 10 1071 0.0E+00
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 397 1008 1.0E-91
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 398 1008 1.0E-90
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 398 1008 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 21 1071 0.0E+00
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 10 1071 0.0E+00
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 397 1008 1.0E-91
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 398 1008 1.0E-90
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 398 1008 1.0E-90
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 398 1008 3.0E-90
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 398 1008 2.0E-87
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 388 1024 6.0E-64
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 77 665 2.0E-62
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 393 1064 6.0E-59
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 399 636 8.0E-57
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 401 638 2.0E-56
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 390 637 2.0E-56
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 386 637 2.0E-56
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 399 636 5.0E-56
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 399 638 3.0E-55
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 400 637 4.0E-55
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 399 641 4.0E-55
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 391 641 9.0E-55
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 399 641 5.0E-54
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 390 641 2.0E-53
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 358 638 2.0E-53
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 371 641 2.0E-53
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 402 698 2.0E-53
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 402 659 7.0E-53
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 393 647 1.0E-52
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 395 636 1.0E-52
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 373 638 5.0E-52
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 399 653 7.0E-52
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 399 653 7.0E-52
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 389 641 2.0E-51
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 399 717 2.0E-51
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 398 638 4.0E-51
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 398 638 7.0E-51
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 383 638 5.0E-50
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 398 693 3.0E-49
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 398 660 1.0E-48
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 398 657 4.0E-48
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 384 638 5.0E-48
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 398 638 7.0E-48
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 394 641 6.0E-47
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 392 654 7.0E-47
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 399 669 1.0E-46
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 400 643 2.0E-46
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 370 697 2.0E-46
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 372 653 3.0E-46
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 399 673 9.0E-46
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 386 673 9.0E-46
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 399 740 1.0E-45
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 399 636 1.0E-45
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 375 1013 6.0E-45
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 399 663 4.0E-44
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 369 638 5.0E-44
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 399 638 6.0E-44
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 399 636 1.0E-43
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 401 651 1.0E-43
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 399 1010 1.0E-43
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 399 636 7.0E-43
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 373 646 1.0E-42
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 401 652 2.0E-42
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 399 916 2.0E-42
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 401 653 2.0E-42
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 373 646 4.0E-42
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 399 638 5.0E-42
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 397 638 7.0E-42
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 353 954 9.0E-42
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 401 638 3.0E-41
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 394 635 6.0E-41
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 399 639 1.0E-40
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 383 646 2.0E-40
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 373 646 2.0E-40
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 366 674 3.0E-40
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 353 679 3.0E-40
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 401 659 4.0E-40
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 384 670 8.0E-40
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 384 674 1.0E-39
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 401 639 1.0E-39
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 384 639 2.0E-39
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 384 647 2.0E-39
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 384 639 2.0E-39
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 384 674 2.0E-39
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 397 639 2.0E-39
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 401 674 5.0E-39
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 399 638 5.0E-39
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 401 639 8.0E-39
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 401 646 1.0E-38
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 383 639 1.0E-38
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 377 643 1.0E-38
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 384 643 2.0E-38
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 373 639 2.0E-38
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 384 674 2.0E-38
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 401 893 2.0E-38
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 389 674 3.0E-38
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 401 645 3.0E-38
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 383 661 3.0E-38
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 397 674 5.0E-38
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 399 637 9.0E-38
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 401 648 9.0E-38
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 401 639 1.0E-37
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 358 645 2.0E-37
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 400 639 2.0E-37
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 398 638 2.0E-37
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 401 637 3.0E-37
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 383 660 3.0E-37
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 401 639 3.0E-37
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 401 692 5.0E-37
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 384 646 7.0E-37
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 384 643 7.0E-37
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 320 639 9.0E-37
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 397 638 9.0E-37
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 359 642 1.0E-36
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 384 646 1.0E-36
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 401 643 1.0E-36
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 394 642 1.0E-36
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 368 645 1.0E-36
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 399 638 1.0E-36
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 384 670 1.0E-36
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 381 637 2.0E-36
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 398 638 2.0E-36
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 398 636 3.0E-36
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 398 1014 4.0E-36
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 398 638 5.0E-36
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 384 639 5.0E-36
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 392 637 7.0E-36
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 383 639 8.0E-36
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 398 638 8.0E-36
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 398 639 8.0E-36
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 401 667 9.0E-36
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 399 638 1.0E-35
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 392 637 3.0E-35
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 384 646 3.0E-35
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 383 639 5.0E-35
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 397 638 1.0E-34
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 366 643 1.0E-34
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 729 1008 3.0E-34
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 399 638 5.0E-34
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 389 1030 1.0E-33
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 370 638 1.0E-33
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 392 637 2.0E-33
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 793 1071 7.0E-33
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 388 1067 2.0E-32
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 401 639 3.0E-32
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 400 646 6.0E-31
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 401 635 1.0E-30
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 397 650 1.0E-30
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 400 649 2.0E-29
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 389 620 3.0E-29
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 400 646 2.0E-28
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 400 649 3.0E-28
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 372 638 3.0E-28
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 391 659 3.0E-28
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 401 645 1.0E-27
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 401 652 2.0E-27
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 391 649 2.0E-27
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 400 646 3.0E-27
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 400 646 3.0E-27
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 401 636 5.0E-27
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 400 646 6.0E-27
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 401 649 1.0E-26
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 400 646 1.0E-26
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 401 649 2.0E-26
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 401 659 4.0E-26
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 401 571 4.0E-26
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 401 649 5.0E-26
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 390 644 5.0E-26
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 401 639 6.0E-26
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 400 639 6.0E-26
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 401 646 1.0E-25
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 400 646 4.0E-25
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 400 671 7.0E-25
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 387 651 7.0E-25
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 400 649 1.0E-24
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 401 649 1.0E-24
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 400 646 1.0E-24
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 401 571 1.0E-24
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 396 586 1.0E-24
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 401 649 2.0E-24
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 400 651 2.0E-24
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 401 870 3.0E-24
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 400 646 4.0E-24
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 401 649 6.0E-24
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 401 649 7.0E-24
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 399 639 7.0E-24
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 656 1008 1.0E-23
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 782 1016 1.0E-23
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 401 639 1.0E-23
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 387 603 2.0E-23
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 400 649 3.0E-23
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 366 649 3.0E-23
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 401 647 4.0E-23
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 400 646 4.0E-23
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 792 1007 5.0E-23
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 401 930 5.0E-23
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 401 870 5.0E-23
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 401 662 6.0E-23
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 401 651 6.0E-23
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 396 586 9.0E-23
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 401 646 1.0E-22
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 782 1063 2.0E-22
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 401 639 2.0E-22
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 400 649 2.0E-22
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 399 718 2.0E-22
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 401 639 4.0E-22
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 737 1063 4.0E-22
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 399 636 5.0E-22
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 401 1009 6.0E-22
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 401 609 8.0E-22
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 780 1013 1.0E-21
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 401 643 1.0E-21
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 401 645 2.0E-21
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 399 640 2.0E-21
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 368 616 2.0E-21
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 401 646 3.0E-21
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 401 645 3.0E-21
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 401 645 3.0E-21
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 401 653 5.0E-21
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 401 649 5.0E-21
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 801 1008 7.0E-21
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 400 649 8.0E-21
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 386 698 9.0E-21
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 792 1063 1.0E-20
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 797 1071 1.0E-20
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 401 639 1.0E-20
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 392 609 1.0E-20
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 792 1007 2.0E-20
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 359 639 2.0E-20
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 393 605 2.0E-20
sp|Q882S0|PHNC2_PSESM Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=phnC2 PE=3 SV=1 386 609 2.0E-20
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 797 1057 3.0E-20
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 401 870 3.0E-20
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 386 628 3.0E-20
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 797 1063 4.0E-20
sp|Q48HL2|PHNC2_PSE14 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=phnC2 PE=3 SV=1 386 609 8.0E-20
sp|Q6N9W0|METN1_RHOPA Methionine import ATP-binding protein MetN 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN1 PE=3 SV=1 402 610 8.0E-20
sp|Q134N9|METN_RHOPS Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB5) GN=metN PE=3 SV=2 402 610 8.0E-20
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 392 609 9.0E-20
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 386 611 9.0E-20
sp|Q9CIQ6|PHNC_LACLA Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=phnC PE=3 SV=1 394 609 1.0E-19
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 368 614 1.0E-19
sp|Q1LQB5|PHNC1_CUPMC Phosphonates import ATP-binding protein PhnC 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=phnC1 PE=3 SV=2 391 609 1.0E-19
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 334 639 2.0E-19
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 386 609 2.0E-19
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 386 614 2.0E-19
sp|Q8YUV1|PHNC1_NOSS1 Phosphonates import ATP-binding protein PhnC 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC1 PE=3 SV=1 390 610 2.0E-19
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 391 609 2.0E-19
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 394 610 2.0E-19
sp|Q46TK4|PHNC_CUPPJ Phosphonates import ATP-binding protein PhnC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=phnC PE=3 SV=1 397 609 2.0E-19
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 796 1066 3.0E-19
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 733 1010 3.0E-19
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 401 649 3.0E-19
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 367 611 3.0E-19
sp|Q4ZU82|PHNC2_PSEU2 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=phnC2 PE=3 SV=1 386 609 3.0E-19
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 387 616 3.0E-19
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 379 609 4.0E-19
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 400 609 4.0E-19
sp|Q7M8M4|PHNC_WOLSU Phosphonates import ATP-binding protein PhnC OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=phnC PE=3 SV=1 397 616 5.0E-19
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 400 609 6.0E-19
sp|Q8XHV3|ECFA2_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA2 PE=3 SV=1 398 651 7.0E-19
sp|Q0TMS8|ECFA2_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA2 PE=3 SV=1 398 651 7.0E-19
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 401 639 8.0E-19
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 396 613 9.0E-19
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 397 620 1.0E-18
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 392 609 1.0E-18
sp|Q1IKM7|LOLD_KORVE Lipoprotein-releasing system ATP-binding protein LolD OS=Koribacter versatilis (strain Ellin345) GN=lolD PE=3 SV=2 398 584 1.0E-18
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 379 609 1.0E-18
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 801 1009 2.0E-18
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 394 629 2.0E-18
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 394 629 2.0E-18
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 394 629 2.0E-18
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 394 629 2.0E-18
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 408 584 2.0E-18
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 399 609 2.0E-18
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 399 609 2.0E-18
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 399 609 2.0E-18
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 399 609 2.0E-18
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 386 616 2.0E-18
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 409 641 2.0E-18
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 394 629 3.0E-18
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 394 629 3.0E-18
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 394 629 3.0E-18
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 394 629 3.0E-18
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 394 629 3.0E-18
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 402 588 3.0E-18
sp|Q1LQF6|METN_CUPMC Methionine import ATP-binding protein MetN OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metN PE=3 SV=1 397 609 3.0E-18
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 387 584 3.0E-18
sp|Q4KKK8|METN1_PSEF5 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN1 PE=3 SV=1 409 641 3.0E-18
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 801 1008 4.0E-18
sp|Q2SXD1|LOLD_BURTA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lolD PE=3 SV=1 401 605 4.0E-18
sp|Q8REG7|PHNC_FUSNN Phosphonates import ATP-binding protein PhnC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=phnC PE=3 SV=1 397 616 4.0E-18
sp|Q21BU8|METN_RHOPB Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB18) GN=metN PE=3 SV=1 402 609 4.0E-18
sp|Q11SW8|LOLD_CYTH3 Lipoprotein-releasing system ATP-binding protein LolD OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lolD PE=3 SV=2 395 606 4.0E-18
sp|Q98DT6|SSUB1_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhizobium loti (strain MAFF303099) GN=ssuB1 PE=3 SV=1 389 605 4.0E-18
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 386 719 4.0E-18
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 386 617 4.0E-18
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 377 636 4.0E-18
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 393 606 4.0E-18
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 402 599 5.0E-18
sp|Q02QM1|PHNC1_PSEAB Phosphonates import ATP-binding protein PhnC 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=phnC1 PE=3 SV=1 404 618 5.0E-18
sp|Q6MMY0|LOLD_BDEBA Lipoprotein-releasing system ATP-binding protein LolD OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lolD PE=3 SV=1 393 584 5.0E-18
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 371 610 6.0E-18
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 397 637 6.0E-18
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 394 621 6.0E-18
sp|Q0KDG3|METN_CUPNH Methionine import ATP-binding protein MetN OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metN PE=3 SV=1 386 609 6.0E-18
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 812 1008 7.0E-18
sp|Q63SP4|LOLD_BURPS Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia pseudomallei (strain K96243) GN=lolD PE=3 SV=2 401 605 7.0E-18
sp|Q62J04|LOLD_BURMA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia mallei (strain ATCC 23344) GN=lolD PE=3 SV=2 401 605 7.0E-18
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 368 614 7.0E-18
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 397 609 7.0E-18
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 386 620 8.0E-18
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 402 618 8.0E-18
sp|Q6XYT0|PSTB_SPIKU Phosphate import ATP-binding protein PstB OS=Spiroplasma kunkelii GN=pstB PE=3 SV=1 380 635 8.0E-18
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 377 636 8.0E-18
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 790 1063 9.0E-18
sp|Q73L25|LOLD_TREDE Lipoprotein-releasing system ATP-binding protein LolD OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lolD PE=3 SV=1 389 605 9.0E-18
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 386 689 9.0E-18
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 386 614 9.0E-18
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 795 1067 1.0E-17
sp|Q032D0|PHNC_LACLS Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=phnC PE=3 SV=1 394 609 1.0E-17
sp|Q890R3|ECFA2_CLOTE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium tetani (strain Massachusetts / E88) GN=ecfA2 PE=3 SV=1 398 645 1.0E-17
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 394 629 1.0E-17
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 386 614 1.0E-17
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 409 609 1.0E-17
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 385 626 1.0E-17
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 394 629 1.0E-17
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 394 629 1.0E-17
sp|Q3ISC1|PHNC1_NATPD Phosphonates import ATP-binding protein PhnC 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC1 PE=3 SV=1 387 606 1.0E-17
sp|Q9HT70|METN2_PSEAE Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN2 PE=3 SV=1 408 609 1.0E-17
sp|Q02DK6|METN2_PSEAB Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN2 PE=3 SV=1 408 609 1.0E-17
sp|Q9HYL7|PHNC2_PSEAE Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnC2 PE=3 SV=1 404 618 1.0E-17
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 385 609 1.0E-17
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 401 584 1.0E-17
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 386 610 1.0E-17
sp|Q89ER4|SSUB_BRADU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ssuB PE=3 SV=1 387 607 1.0E-17
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 386 610 1.0E-17
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 386 719 1.0E-17
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 398 610 1.0E-17
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 798 1008 2.0E-17
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 731 1007 2.0E-17
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 386 719 2.0E-17
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 386 610 2.0E-17
sp|Q8KFE9|MACB_CHLTE Macrolide export ATP-binding/permease protein MacB OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=macB PE=3 SV=1 393 606 2.0E-17
sp|Q2W7J9|PSTB2_MAGSA Phosphate import ATP-binding protein PstB 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pstB2 PE=3 SV=1 391 629 2.0E-17
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 386 617 2.0E-17
sp|Q7N3S7|HMUV_PHOLL Hemin import ATP-binding protein HmuV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hmuV PE=3 SV=1 386 609 2.0E-17
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 387 637 2.0E-17
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 390 609 2.0E-17
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 386 614 2.0E-17
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 398 614 2.0E-17
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 399 609 2.0E-17
sp|Q895C4|METN_CLOTE Methionine import ATP-binding protein MetN OS=Clostridium tetani (strain Massachusetts / E88) GN=metN PE=3 SV=1 396 605 2.0E-17
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 402 603 2.0E-17
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 791 1071 3.0E-17
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 393 637 3.0E-17
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 386 614 3.0E-17
sp|P57383|LOLD_BUCAI Lipoprotein-releasing system ATP-binding protein LolD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lolD PE=3 SV=1 393 586 3.0E-17
sp|P15361|P29_MYCHR Probable ABC transporter ATP-binding protein p29 OS=Mycoplasma hyorhinis PE=3 SV=1 398 600 3.0E-17
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 400 609 3.0E-17
sp|Q18CJ0|ECFA1_PEPD6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Peptoclostridium difficile (strain 630) GN=ecfA1 PE=3 SV=1 402 637 3.0E-17
sp|Q8ZRM9|METN1_SALTY Methionine import ATP-binding protein MetN 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN1 PE=3 SV=1 394 629 3.0E-17
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 409 609 3.0E-17
sp|Q5WKL3|METN1_BACSK Methionine import ATP-binding protein MetN 1 OS=Bacillus clausii (strain KSM-K16) GN=metN1 PE=3 SV=1 393 629 3.0E-17
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 383 611 3.0E-17
sp|Q5XBY7|PSTB1_STRP6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pstB1 PE=3 SV=2 387 580 4.0E-17
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 369 613 4.0E-17
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 394 629 4.0E-17
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 368 612 4.0E-17
sp|Q07LR5|METN_RHOP5 Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisA53) GN=metN PE=3 SV=1 402 610 4.0E-17
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 397 609 4.0E-17
sp|Q57T09|METN1_SALCH Methionine import ATP-binding protein MetN 1 OS=Salmonella choleraesuis (strain SC-B67) GN=metN1 PE=3 SV=2 394 629 4.0E-17
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 387 611 4.0E-17
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 387 611 4.0E-17
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 402 609 4.0E-17
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 394 629 4.0E-17
sp|P0CZ37|PSTB1_STRPQ Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pstB1 PE=3 SV=1 387 580 4.0E-17
sp|P63377|PSTB1_STRP8 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pstB1 PE=3 SV=1 387 580 4.0E-17
sp|P0CZ36|PSTB1_STRP3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pstB1 PE=3 SV=1 387 580 4.0E-17
sp|P63375|PSTB1_STRP1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M1 GN=pstB1 PE=3 SV=1 387 580 4.0E-17
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 797 1071 5.0E-17
sp|Q12XW6|PSTB_METBU Phosphate import ATP-binding protein PstB OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pstB PE=3 SV=1 378 620 5.0E-17
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 384 642 5.0E-17
sp|Q2JB14|PHNC_FRASC Phosphonates import ATP-binding protein PhnC OS=Frankia sp. (strain CcI3) GN=phnC PE=3 SV=1 385 610 5.0E-17
sp|Q48TC3|PSTB1_STRPM Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pstB1 PE=3 SV=1 387 580 5.0E-17
sp|Q1J6D2|PSTB1_STRPF Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pstB1 PE=3 SV=1 387 580 5.0E-17
sp|Q1JGL3|PSTB1_STRPD Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pstB1 PE=3 SV=1 387 580 5.0E-17
sp|Q70YG7|HMUV_VIBA7 Hemin import ATP-binding protein HmuV OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=hmuV PE=1 SV=2 390 606 5.0E-17
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 379 744 5.0E-17
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 387 614 5.0E-17
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 384 642 5.0E-17
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 382 618 5.0E-17
sp|P75370|P29_MYCPN Probable ABC transporter ATP-binding protein p29 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=p29 PE=3 SV=1 387 600 5.0E-17
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 392 609 6.0E-17
sp|Q1JLH7|PSTB1_STRPC Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pstB1 PE=3 SV=1 387 590 6.0E-17
sp|Q1JBJ5|PSTB1_STRPB Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pstB1 PE=3 SV=1 387 590 6.0E-17
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 402 613 6.0E-17
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 386 616 6.0E-17
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 399 606 6.0E-17
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 399 606 6.0E-17
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 386 603 6.0E-17
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 798 1065 7.0E-17
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 371 611 7.0E-17
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 386 629 8.0E-17
sp|Q9V1Q4|Y373_PYRAB Putative ABC transporter ATP-binding protein PYRAB03730 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB03730 PE=3 SV=1 388 658 8.0E-17
sp|Q04F14|METN1_OENOB Methionine import ATP-binding protein MetN 1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN1 PE=3 SV=1 402 609 8.0E-17
sp|Q2ISN3|PHNC2_RHOP2 Phosphonates import ATP-binding protein PhnC 2 OS=Rhodopseudomonas palustris (strain HaA2) GN=phnC2 PE=3 SV=1 387 610 8.0E-17
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 394 629 8.0E-17
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 394 629 8.0E-17
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 394 629 8.0E-17
sp|Q88WA5|METN1_LACPL Methionine import ATP-binding protein MetN 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN1 PE=3 SV=1 402 629 8.0E-17
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 387 620 8.0E-17
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 390 610 8.0E-17
sp|Q1GKZ0|PHNC2_RUEST Phosphonates import ATP-binding protein PhnC 2 OS=Ruegeria sp. (strain TM1040) GN=phnC2 PE=3 SV=1 387 620 8.0E-17
sp|Q9AB70|PHNC_CAUCR Phosphonates import ATP-binding protein PhnC OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=phnC PE=3 SV=1 387 614 9.0E-17
sp|Q64Z80|LOLD_BACFR Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain YCH46) GN=lolD PE=3 SV=1 387 584 9.0E-17
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 370 605 1.0E-16
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 379 637 1.0E-16
sp|Q7A7E3|METN1_STAAN Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain N315) GN=metN1 PE=3 SV=1 402 620 1.0E-16
sp|Q99WE1|METN1_STAAM Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN1 PE=3 SV=1 402 620 1.0E-16
sp|Q5LI72|LOLD_BACFN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lolD PE=3 SV=1 387 584 1.0E-16
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 379 609 1.0E-16
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 387 590 1.0E-16
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 372 614 1.0E-16
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 372 614 1.0E-16
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 372 614 1.0E-16
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 372 614 1.0E-16
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 372 614 1.0E-16
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 372 614 1.0E-16
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 372 614 1.0E-16
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 372 614 1.0E-16
sp|Q62H59|PHNC_BURMA Phosphonates import ATP-binding protein PhnC OS=Burkholderia mallei (strain ATCC 23344) GN=phnC PE=3 SV=1 399 609 1.0E-16
sp|Q6KIS8|PSTB_MYCMO Phosphate import ATP-binding protein PstB OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=pstB PE=3 SV=1 394 606 1.0E-16
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 345 613 1.0E-16
sp|Q13X01|LOLD_BURXL Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia xenovorans (strain LB400) GN=lolD PE=3 SV=1 368 586 1.0E-16
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 387 635 1.0E-16
sp|Q3IL62|LOLD_PSEHT Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lolD PE=3 SV=1 401 607 1.0E-16
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 798 1008 2.0E-16
sp|Q9HNI8|PHNC_HALSA Phosphonates import ATP-binding protein PhnC OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=phnC PE=3 SV=1 385 678 2.0E-16
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 386 620 2.0E-16
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 387 620 2.0E-16
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 393 637 2.0E-16
sp|Q63R24|PHNC_BURPS Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain K96243) GN=phnC PE=3 SV=2 399 609 2.0E-16
sp|Q3JNY2|PHNC_BURP1 Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain 1710b) GN=phnC PE=3 SV=1 399 609 2.0E-16
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 386 609 2.0E-16
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 392 584 2.0E-16
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 402 669 2.0E-16
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 386 610 2.0E-16
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 397 609 2.0E-16
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 401 606 2.0E-16
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 393 635 2.0E-16
sp|Q8EB59|HMUV_SHEON Hemin import ATP-binding protein HmuV OS=Shewanella oneidensis (strain MR-1) GN=hmuV PE=3 SV=1 392 609 2.0E-16
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 385 656 2.0E-16
sp|Q83CV2|LOLD_COXBU Lipoprotein-releasing system ATP-binding protein LolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lolD PE=3 SV=1 401 605 2.0E-16
sp|Q6A6X6|METN_PROAC Methionine import ATP-binding protein MetN OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metN PE=3 SV=1 384 614 2.0E-16
sp|Q2NRN5|METN_SODGM Methionine import ATP-binding protein MetN OS=Sodalis glossinidius (strain morsitans) GN=metN PE=3 SV=1 393 647 2.0E-16
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 371 616 2.0E-16
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 393 605 2.0E-16
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 378 614 2.0E-16
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 398 611 2.0E-16
sp|Q85A69|CYSA_ANTFO Sulfate/thiosulfate import ATP-binding protein CysA OS=Anthoceros formosae GN=cysA PE=2 SV=1 392 621 2.0E-16
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 386 609 2.0E-16
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 402 610 2.0E-16
sp|A3CVD3|ECFA_METMJ Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ecfA PE=3 SV=1 397 626 2.0E-16
sp|Q1WSB9|ECFA2_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA2 PE=3 SV=1 393 606 2.0E-16
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 795 1008 3.0E-16
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 798 1039 3.0E-16
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 382 616 3.0E-16
sp|P10091|CYSA_MARPO Sulfate/thiosulfate import ATP-binding protein CysA OS=Marchantia polymorpha GN=cysA PE=3 SV=1 386 621 3.0E-16
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 357 612 3.0E-16
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 389 585 3.0E-16
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 378 617 3.0E-16
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 392 609 3.0E-16
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 371 616 3.0E-16
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 371 616 3.0E-16
sp|P49938|FHUC_BACSU Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Bacillus subtilis (strain 168) GN=fhuC PE=3 SV=1 391 609 3.0E-16
sp|Q8A1M1|LOLD_BACTN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lolD PE=3 SV=1 389 584 3.0E-16
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 396 602 3.0E-16
sp|Q8ZQE4|MACB_SALTY Macrolide export ATP-binding/permease protein MacB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=macB PE=3 SV=1 393 608 3.0E-16
sp|Q57R58|MACB_SALCH Macrolide export ATP-binding/permease protein MacB OS=Salmonella choleraesuis (strain SC-B67) GN=macB PE=3 SV=1 393 608 3.0E-16
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 398 613 3.0E-16
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 400 586 3.0E-16
sp|Q5PGK9|MACB_SALPA Macrolide export ATP-binding/permease protein MacB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=macB PE=3 SV=1 393 608 3.0E-16
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 400 610 3.0E-16
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 390 610 3.0E-16
sp|Q8Z824|MACB_SALTI Macrolide export ATP-binding/permease protein MacB OS=Salmonella typhi GN=macB PE=3 SV=1 393 608 3.0E-16
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 393 604 3.0E-16
sp|Q5HV18|METN_CAMJR Methionine import ATP-binding protein MetN OS=Campylobacter jejuni (strain RM1221) GN=metN PE=3 SV=1 397 644 3.0E-16
sp|Q0PAB6|METN_CAMJE Methionine import ATP-binding protein MetN OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=metN PE=3 SV=1 397 644 3.0E-16
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 390 610 4.0E-16
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 390 610 4.0E-16
sp|Q6RCE0|PHNC_PSEST Phosphonates import ATP-binding protein PhnC OS=Pseudomonas stutzeri GN=phnC PE=3 SV=1 409 609 4.0E-16
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 389 640 4.0E-16
sp|Q12L15|PSTB_SHEDO Phosphate import ATP-binding protein PstB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pstB PE=3 SV=1 385 635 4.0E-16
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 392 620 4.0E-16
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 365 614 4.0E-16
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 371 611 4.0E-16
sp|Q3B276|LOLD2_CHLL7 Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lolD2 PE=3 SV=1 399 584 4.0E-16
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 393 606 4.0E-16
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 405 610 4.0E-16
sp|Q74AT2|LOLD_GEOSL Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lolD PE=3 SV=1 393 587 4.0E-16
sp|Q1R0Z6|PHNC_CHRSD Phosphonates import ATP-binding protein PhnC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=phnC PE=3 SV=1 393 610 4.0E-16
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 372 616 5.0E-16
sp|Q5HIL5|METN1_STAAC Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain COL) GN=metN1 PE=3 SV=1 402 609 5.0E-16
sp|Q2G0V2|METN1_STAA8 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN1 PE=3 SV=1 402 609 5.0E-16
sp|Q2FJI0|METN1_STAA3 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain USA300) GN=metN1 PE=3 SV=1 402 609 5.0E-16
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 387 614 5.0E-16
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 398 616 5.0E-16
sp|O66646|LOLD_AQUAE Lipoprotein-releasing system ATP-binding protein LolD OS=Aquifex aeolicus (strain VF5) GN=lolD PE=1 SV=1 401 585 5.0E-16
sp|Q8RD43|RBSA_CALS4 Ribose import ATP-binding protein RbsA OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rbsA PE=3 SV=1 387 614 5.0E-16
sp|Q748K0|Y3001_GEOSL Putative ABC transporter ATP-binding protein GSU3001 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU3001 PE=3 SV=1 393 609 5.0E-16
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 371 611 5.0E-16
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 788 1071 6.0E-16
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 371 614 6.0E-16
sp|Q5HC57|LOLD_EHRRW Lipoprotein-releasing system ATP-binding protein LolD OS=Ehrlichia ruminantium (strain Welgevonden) GN=lolD PE=3 SV=1 389 605 6.0E-16
sp|Q5FFC0|LOLD_EHRRG Lipoprotein-releasing system ATP-binding protein LolD OS=Ehrlichia ruminantium (strain Gardel) GN=lolD PE=3 SV=2 389 605 6.0E-16
sp|Q2GE91|LOLD_NEOSM Lipoprotein-releasing system ATP-binding protein LolD OS=Neorickettsia sennetsu (strain Miyayama) GN=lolD PE=3 SV=1 386 586 6.0E-16
sp|Q18C09|METN_PEPD6 Methionine import ATP-binding protein MetN OS=Peptoclostridium difficile (strain 630) GN=metN PE=3 SV=1 397 585 6.0E-16
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 392 609 6.0E-16
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 394 646 6.0E-16
sp|Q8NY21|METN1_STAAW Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MW2) GN=metN1 PE=3 SV=1 402 620 6.0E-16
sp|Q6GC27|METN1_STAAS Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MSSA476) GN=metN1 PE=3 SV=1 402 620 6.0E-16
sp|Q20Y31|PHNC2_RHOPB Phosphonates import ATP-binding protein PhnC 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=phnC2 PE=3 SV=1 387 667 6.0E-16
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 397 609 6.0E-16
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 381 613 7.0E-16
sp|Q63GR8|METN2_BACCZ Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ZK / E33L) GN=metN2 PE=3 SV=1 389 609 7.0E-16
sp|Q254K9|METN_CHLFF Methionine import ATP-binding protein MetN OS=Chlamydophila felis (strain Fe/C-56) GN=metN PE=3 SV=1 392 585 7.0E-16
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 402 669 7.0E-16
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 369 613 7.0E-16
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 370 616 7.0E-16
sp|Q2LVM2|LOLD_SYNAS Lipoprotein-releasing system ATP-binding protein LolD OS=Syntrophus aciditrophicus (strain SB) GN=lolD PE=3 SV=1 397 584 7.0E-16
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 402 669 7.0E-16
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 398 616 7.0E-16
sp|Q47YG8|LOLD_COLP3 Lipoprotein-releasing system ATP-binding protein LolD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lolD PE=3 SV=1 393 584 7.0E-16
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 386 610 7.0E-16
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 357 613 8.0E-16
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 357 613 8.0E-16
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 402 609 8.0E-16
sp|Q2P7S3|METN_XANOM Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metN PE=3 SV=1 393 620 8.0E-16
sp|Q4W575|FBPC_NEIMB Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbpC PE=3 SV=1 386 610 8.0E-16
sp|Q9JVH1|FBPC_NEIMA Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbpC PE=3 SV=1 386 610 8.0E-16
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 400 602 8.0E-16
sp|Q2NHW1|PSTB_METST Phosphate import ATP-binding protein PstB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pstB PE=3 SV=1 398 584 8.0E-16
sp|Q1RK34|LOLD_RICBR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia bellii (strain RML369-C) GN=lolD PE=3 SV=1 401 608 8.0E-16
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 399 611 8.0E-16
sp|P54954|YXEO_BACSU Probable amino-acid import ATP-binding protein YxeO OS=Bacillus subtilis (strain 168) GN=yxeO PE=1 SV=1 392 609 8.0E-16
sp|Q1RE44|MACB_ECOUT Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain UTI89 / UPEC) GN=macB PE=3 SV=1 393 606 8.0E-16
sp|A1A9B7|MACB1_ECOK1 Macrolide export ATP-binding/permease protein MacB 1 OS=Escherichia coli O1:K1 / APEC GN=macB1 PE=3 SV=1 393 606 8.0E-16
sp|Q180A5|PSTB_PEPD6 Phosphate import ATP-binding protein PstB OS=Peptoclostridium difficile (strain 630) GN=pstB PE=3 SV=1 397 584 9.0E-16
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 386 610 9.0E-16
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 371 616 9.0E-16
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 371 616 9.0E-16
sp|Q0TJH0|MACB_ECOL5 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=macB PE=3 SV=1 393 606 9.0E-16
sp|Q6GJL2|METN1_STAAR Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MRSA252) GN=metN1 PE=3 SV=1 402 620 9.0E-16
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 398 613 9.0E-16
sp|Q1QCN2|LOLD_PSYCK Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter cryohalolentis (strain K5) GN=lolD PE=3 SV=1 401 603 9.0E-16
sp|Q39IE7|METN1_BURL3 Methionine import ATP-binding protein MetN 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN1 PE=3 SV=1 404 609 9.0E-16
sp|Q73EL7|METN2_BACC1 Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN2 PE=3 SV=1 389 609 9.0E-16
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 400 629 9.0E-16
sp|P75831|MACB_ECOLI Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain K12) GN=macB PE=1 SV=1 393 606 1.0E-15
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 384 621 1.0E-15
sp|A0K739|SSUB1_BURCH Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia cenocepacia (strain HI2424) GN=ssuB1 PE=3 SV=1 386 610 1.0E-15
sp|Q1BWL4|SSUB1_BURCA Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=ssuB1 PE=3 SV=1 386 610 1.0E-15
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 385 609 1.0E-15
sp|Q73P71|PHNC_TREDE Phosphonates import ATP-binding protein PhnC OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=phnC PE=3 SV=1 393 609 1.0E-15
sp|Q7NTU0|LOLD_CHRVO Lipoprotein-releasing system ATP-binding protein LolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lolD PE=3 SV=1 395 584 1.0E-15
sp|Q834B3|PSTB2_ENTFA Phosphate import ATP-binding protein PstB 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pstB2 PE=3 SV=1 370 584 1.0E-15
sp|Q5H503|METN_XANOR Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metN PE=3 SV=2 393 620 1.0E-15
sp|Q7MU65|LOLD_PORGI Lipoprotein-releasing system ATP-binding protein LolD OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lolD PE=3 SV=1 392 587 1.0E-15
sp|Q8PVG9|Y1996_METMA Putative ABC transporter ATP-binding protein MM_1996 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1996 PE=3 SV=1 400 626 1.0E-15
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 386 603 1.0E-15
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 393 606 1.0E-15
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 386 606 1.0E-15
sp|Q46Y69|METN_CUPPJ Methionine import ATP-binding protein MetN OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metN PE=3 SV=1 397 609 1.0E-15
sp|Q32DZ9|MACB_SHIDS Macrolide export ATP-binding/permease protein MacB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=macB PE=3 SV=1 393 606 1.0E-15
sp|Q9EYM2|LOLD_ACIAD Lipoprotein-releasing system ATP-binding protein LolD OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lolD PE=3 SV=1 401 584 1.0E-15
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 402 624 1.0E-15
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 397 609 1.0E-15
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 397 609 1.0E-15
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 399 611 1.0E-15
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 398 613 1.0E-15
sp|Q5WET8|PSTB1_BACSK Phosphate import ATP-binding protein PstB 1 OS=Bacillus clausii (strain KSM-K16) GN=pstB1 PE=3 SV=1 379 620 1.0E-15
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 381 603 2.0E-15
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 386 609 2.0E-15
sp|Q8NQH4|PHNC_CORGL Phosphonates import ATP-binding protein PhnC OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=phnC PE=3 SV=1 392 616 2.0E-15
sp|A1BE50|MACB_CHLPD Macrolide export ATP-binding/permease protein MacB OS=Chlorobium phaeobacteroides (strain DSM 266) GN=macB PE=3 SV=1 393 606 2.0E-15
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 402 669 2.0E-15
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 394 610 2.0E-15
sp|O32188|YUSV_BACSU Probable siderophore transport system ATP-binding protein YusV OS=Bacillus subtilis (strain 168) GN=yusV PE=1 SV=1 392 608 2.0E-15
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 365 616 2.0E-15
sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ZK / E33L) GN=metN1 PE=3 SV=1 397 666 2.0E-15
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 398 605 2.0E-15
sp|Q222W0|PHNC1_RHOFT Phosphonates import ATP-binding protein PhnC 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=phnC1 PE=3 SV=1 397 609 2.0E-15
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 401 616 2.0E-15
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 401 616 2.0E-15
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 374 609 2.0E-15
sp|Q21XJ9|SSUB_RHOFT Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ssuB PE=3 SV=1 387 605 2.0E-15
sp|Q21XK2|METN_RHOFT Methionine import ATP-binding protein MetN OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=metN PE=3 SV=1 402 610 2.0E-15
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 387 659 2.0E-15
sp|Q1B677|METN_MYCSS Methionine import ATP-binding protein MetN OS=Mycobacterium sp. (strain MCS) GN=metN PE=3 SV=2 387 614 2.0E-15
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 398 613 2.0E-15
sp|A0K5N5|METN1_BURCH Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain HI2424) GN=metN1 PE=3 SV=2 402 609 2.0E-15
sp|Q1BY14|METN1_BURCA Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN1 PE=3 SV=2 402 609 2.0E-15
sp|Q084V3|PSTB_SHEFN Phosphate import ATP-binding protein PstB OS=Shewanella frigidimarina (strain NCIMB 400) GN=pstB PE=3 SV=1 385 635 2.0E-15
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 392 635 2.0E-15
sp|Q9KFL0|PHNC2_BACHD Phosphonates import ATP-binding protein PhnC 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=phnC2 PE=3 SV=2 387 617 2.0E-15
sp|Q0SFY5|METN1_RHOJR Methionine import ATP-binding protein MetN 1 OS=Rhodococcus jostii (strain RHA1) GN=metN1 PE=3 SV=1 394 609 2.0E-15
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 379 590 2.0E-15
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 379 590 2.0E-15
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 798 1009 4.0E-15
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 798 1007 8.0E-15
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 381 603 9.0E-15
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 791 1071 1.0E-14
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 381 603 1.0E-14
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 774 1071 2.0E-14
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 790 1008 2.0E-14
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 381 603 2.0E-14
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 801 1008 3.0E-14
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 801 1008 3.0E-14
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 793 1071 5.0E-14
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 381 603 5.0E-14
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 790 1008 7.0E-14
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 783 1060 1.0E-13
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 710 1008 1.0E-13
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 402 618 2.0E-13
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 369 613 4.0E-13
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 797 1008 2.0E-12
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 703 1008 2.0E-12
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 791 1071 5.0E-12
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 735 1009 5.0E-12
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 729 1070 6.0E-12
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 716 1007 1.0E-11
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 811 989 1.0E-11
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 811 989 1.0E-11
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 821 991 1.0E-11
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 451 664 2.0E-11
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 703 1013 4.0E-11
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 703 1009 5.0E-11
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 751 1070 7.0E-11
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 402 584 7.0E-11
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 704 1008 1.0E-10
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 381 558 1.0E-10
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 409 611 1.0E-10
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 811 991 2.0E-10
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 811 993 3.0E-10
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 793 994 4.0E-10
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 780 1065 4.0E-10
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 759 1021 4.0E-10
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 398 611 4.0E-10
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 488 627 5.0E-10
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 811 991 7.0E-10
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 811 989 9.0E-10
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 753 1051 1.0E-09
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 782 1040 1.0E-09
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 794 1023 2.0E-09
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 742 994 3.0E-09
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 787 1009 4.0E-09
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 792 1066 4.0E-09
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 811 989 7.0E-09
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 729 1003 1.0E-08
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 850 1055 1.0E-08
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 774 1013 1.0E-08
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 401 639 1.0E-08
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 787 1013 2.0E-08
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 811 989 2.0E-08
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 747 1057 2.0E-08
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 792 1067 4.0E-08
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 339 613 4.0E-08
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 729 994 5.0E-08
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 339 613 5.0E-08
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 846 1064 7.0E-08
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 735 1009 7.0E-08
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 740 994 8.0E-08
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 735 1003 9.0E-08
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 827 1058 9.0E-08
sp|Q8PVG9|Y1996_METMA Putative ABC transporter ATP-binding protein MM_1996 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1996 PE=3 SV=1 399 609 9.0E-08
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 739 1065 1.0E-07
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 778 991 1.0E-07
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 709 994 1.0E-07
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 846 1064 2.0E-07
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 811 991 2.0E-07
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 798 1013 2.0E-07
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 403 632 3.0E-07
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 797 1007 4.0E-07
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 805 991 4.0E-07
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 827 1058 4.0E-07
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 756 1009 4.0E-07
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 747 993 4.0E-07
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 839 1064 5.0E-07
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 794 1009 5.0E-07
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 801 1007 7.0E-07
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 787 994 7.0E-07
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 850 1068 7.0E-07
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 849 1058 8.0E-07
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 784 1048 1.0E-06
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 703 1009 1.0E-06
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 797 1013 1.0E-06
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 801 1007 2.0E-06
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 809 1008 2.0E-06
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 849 1008 2.0E-06
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 811 993 2.0E-06
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 734 994 2.0E-06
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 735 1018 2.0E-06
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 735 1018 2.0E-06
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 798 1003 3.0E-06
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 841 1058 3.0E-06
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 798 1070 4.0E-06
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 849 1008 4.0E-06
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 861 1057 4.0E-06
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 747 993 4.0E-06
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 735 994 4.0E-06
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 751 994 4.0E-06
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 575 652 4.0E-06
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 805 989 5.0E-06
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 798 994 5.0E-06
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 754 1003 6.0E-06
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 742 1039 6.0E-06
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 792 1008 6.0E-06
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 747 993 7.0E-06
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 850 1065 7.0E-06
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 805 991 8.0E-06
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 805 991 8.0E-06
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 811 989 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0016020 membrane Yes
GO:0015399 primary active transmembrane transporter activity No
GO:0036094 small molecule binding No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0140657 ATP-dependent activity No
GO:0005575 cellular_component No
GO:0022804 active transmembrane transporter activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 333 355 22
2 817 839 22
3 849 871 22
4 900 922 22
5 927 949 22
6 956 978 22
7 1045 1067 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|086350
MSFLTPNALRTMPWSLLLLILSSTWVTAQRNQSVLDRQLDNGTSLPTALSLDYALAPGRCPPCFNCLLPAFTCGQ
YGQCNKFNGQCECPPGWSGIDCLTPQCDSLADRDHRRPRREGESCQCKDGWGGVNCNVCQNDNACAGFPIPEVSS
LLDGDNGGNMTCYKGGETVFSNHQMCNVTNRKILDMLPDRPPQVTFSCDRQDSTCSFQFWTAEVESFYCALEGCT
SETQPGYDTNTTIYACDKIKCSCVTGRFLCGESGSIDIGDFLKEEIRGPAQFSCKTGNGCKFEEPAMNDLIDSVF
GDSYITLQCEGGECLHYSQVPGYVRPPKPRNNLWLALSSSGAIVIVLLSSAVLWYAGRIGKGGDFGKIRLPEAET
AKLMSDHVPTSLYFSGISYSLGDRTIIDNISGNVKSGQVMAIMGASGAGKSTFLDILARKNKRGVVTGSMLVNGR
EVKDSEFKKVAGFVDQEDTLMSTLTVYETVLYSALLRLPRDMSFEAKKFRTLETMNELGILDIRDSRIGDSGTRS
ISGGEKRRVSIACELVTSPSILFLDEPTSGLDSFNAFNVVECLVSLARDYNRTVVFTIHQPRSNIVALFDQLVVL
GAGKLVYSGAYSKCPEYFTSIGYPCPTGFNIADYLIDLTMQASMERKDNGNSRSSVLASSSATSPAGDEEQGLPV
APHSAALSVRSNISANGIPEDTDESVVSSTGDYLRKKTSQIVNAVSSFASNRGPDASITPKLASLVQSYVDSTIA
ADIKAEGEEIARQASLATTRDSASRQLPDVAEETSLLRGRKRASWGTQFRILSGRAFKNLYRDPALLAAHYLSAI
GLAVLCGLFYHNITNDIAGFQNRLGLFFFTLALFGFSCLSSLGLFANERILFMRERSNGYYSTFTYFSSKILFDI
LPLRLVPPLMFGGIVYGLVGLVPTVAGFWKFLLALVLFNLTTASVVLLLSIVFDSISVASLVGTLVMLFNLMFTG
LLINRDTVPVAFRWLHTISFFHAAFESLAVNELRYLQLKEVKYGVELDVPAATILSTFGLRAQSYWWPNISLLGI
FFAVFTIGSFMYLHFFVKERR*
Coding >AgabiH97|086350
ATGTCGTTTCTGACGCCAAACGCGTTGAGGACCATGCCTTGGTCCTTGCTTCTACTCATACTATCGTCGACTTGG
GTTACTGCGCAGCGGAATCAATCCGTCCTTGATCGCCAGCTGGACAACGGGACTTCACTTCCGACCGCGTTGTCA
CTGGATTATGCGCTTGCGCCTGGAAGATGCCCACCTTGTTTCAATTGTCTGCTTCCGGCATTTACTTGCGGCCAA
TATGGACAGTGCAACAAGTTTAATGGCCAGTGTGAATGCCCTCCCGGCTGGTCCGGCATCGATTGTCTTACTCCT
CAGTGCGATTCCCTTGCGGATCGTGACCACCGAAGACCCAGAAGAGAAGGAGAATCATGCCAGTGCAAGGATGGC
TGGGGAGGCGTCAATTGCAATGTGTGTCAGAACGACAATGCTTGCGCCGGCTTTCCCATTCCTGAAGTTTCATCG
CTTCTTGACGGTGACAACGGCGGAAACATGACTTGTTATAAGGGTGGAGAAACGGTTTTCAGTAATCATCAAATG
TGCAATGTGACCAACAGAAAAATACTCGATATGCTTCCAGACCGTCCGCCACAAGTGACATTTAGCTGTGATCGT
CAAGACTCAACCTGTTCCTTCCAGTTCTGGACTGCAGAGGTCGAATCCTTCTATTGTGCGTTGGAGGGATGCACC
TCGGAAACACAGCCAGGTTACGACACGAATACAACAATATATGCATGTGATAAAATCAAATGTAGCTGCGTTACC
GGTCGTTTCTTATGTGGCGAGTCTGGTAGTATTGATATTGGCGATTTCTTGAAGGAAGAAATACGGGGTCCGGCT
CAGTTCAGCTGCAAGACTGGCAACGGCTGCAAGTTTGAAGAGCCGGCTATGAACGATCTCATCGACAGTGTATTT
GGTGATAGCTACATCACGTTGCAATGCGAGGGAGGAGAATGTCTTCATTACTCCCAAGTCCCAGGATATGTGCGA
CCCCCCAAACCGAGAAATAATCTCTGGCTTGCACTCAGTTCCTCGGGGGCGATCGTCATCGTGTTACTTTCTTCA
GCTGTCCTCTGGTATGCTGGTCGCATAGGGAAGGGGGGCGATTTTGGAAAGATCCGTCTTCCAGAGGCAGAAACT
GCGAAACTAATGTCGGACCATGTTCCTACTTCCCTCTATTTCTCTGGAATATCATATTCCCTTGGTGATCGTACC
ATCATCGACAATATATCAGGTAATGTCAAATCAGGGCAGGTCATGGCCATCATGGGAGCGTCTGGTGCAGGAAAG
TCGACCTTCCTTGACATTCTTGCACGCAAGAACAAGCGAGGTGTTGTTACTGGCTCCATGTTAGTGAATGGGCGG
GAGGTGAAGGACAGTGAATTCAAGAAGGTTGCGGGTTTTGTTGACCAAGAGGATACTTTGATGTCTACGTTGACT
GTCTACGAGACAGTCTTGTACAGCGCACTACTGAGGTTGCCGAGGGACATGAGTTTCGAGGCGAAAAAATTTCGG
ACCTTGGAGACCATGAATGAGCTAGGTATACTCGATATCAGGGATTCAAGAATCGGTGATTCTGGAACGCGTTCG
ATATCTGGGGGTGAAAAACGTCGTGTTTCAATTGCATGCGAGCTTGTCACAAGCCCGTCTATTTTGTTTTTGGAC
GAACCTACGAGTGGACTGGACTCCTTTAACGCATTCAACGTTGTTGAGTGCTTGGTTTCCCTTGCCCGCGATTAC
AACCGGACAGTTGTGTTCACTATCCATCAACCCCGTAGCAACATCGTCGCATTATTCGACCAACTTGTGGTTCTG
GGTGCCGGTAAACTAGTTTATTCTGGTGCATACTCAAAGTGCCCGGAATACTTTACATCGATCGGCTACCCTTGC
CCAACCGGGTTCAACATCGCCGATTATCTCATTGACCTGACGATGCAAGCTAGCATGGAACGCAAAGACAATGGG
AACAGCCGATCTAGCGTGCTTGCCTCATCTTCTGCTACGTCTCCAGCTGGCGATGAAGAACAAGGTCTTCCTGTA
GCTCCTCACTCCGCTGCCTTATCGGTTCGGTCCAACATATCCGCCAATGGTATACCAGAGGACACTGATGAATCT
GTTGTCTCCTCCACGGGCGATTATCTACGGAAGAAGACGTCCCAGATTGTCAATGCTGTCAGTTCTTTTGCTTCA
AATCGTGGCCCGGATGCTTCGATTACGCCGAAACTGGCTTCACTCGTACAGTCATATGTTGATAGCACGATAGCT
GCGGATATCAAAGCTGAGGGAGAAGAAATTGCTCGACAGGCGTCGCTGGCAACTACCCGTGATTCTGCGAGTAGG
CAACTGCCAGATGTTGCGGAGGAAACGTCATTGTTGCGTGGACGCAAGAGAGCATCTTGGGGTACTCAATTCAGA
ATTTTGAGTGGGAGAGCATTCAAGAACTTGTATCGTGACCCTGCGTTGCTGGCCGCCCATTACTTGTCCGCAATT
GGACTAGCAGTGCTTTGTGGACTGTTCTACCATAATATCACCAACGACATCGCTGGCTTCCAAAACCGTCTTGGA
CTCTTTTTTTTCACTTTAGCTCTATTTGGATTCTCTTGCTTGTCAAGTCTTGGTCTGTTTGCAAATGAGCGGATC
TTATTCATGCGCGAGCGCTCGAATGGTTACTACTCTACATTCACATACTTTTCATCGAAGATCTTATTCGATATC
CTCCCCCTCCGACTTGTTCCCCCTCTTATGTTTGGTGGTATCGTGTATGGCCTTGTTGGGCTTGTACCTACTGTC
GCCGGCTTTTGGAAGTTCCTACTTGCATTGGTCCTCTTTAACCTTACTACAGCGAGTGTTGTTTTACTGCTCTCT
ATCGTGTTTGACAGCATCAGCGTGGCGAGCTTGGTTGGAACATTGGTCATGCTGTTCAACCTTATGTTCACTGGT
TTACTCATCAACCGTGATACGGTTCCGGTGGCGTTCAGATGGCTGCACACGATCTCGTTCTTCCATGCCGCATTC
GAGTCTCTTGCTGTGAACGAGCTACGATACCTGCAATTGAAGGAAGTCAAGTATGGCGTCGAGTTGGATGTACCT
GCTGCAACTATTTTGTCGACTTTTGGACTTCGAGCCCAGTCGTATTGGTGGCCAAACATCTCGCTACTCGGAATT
TTCTTTGCTGTGTTTACTATTGGGAGCTTTATGTACCTGCATTTCTTTGTGAAGGAAAGGCGATAA
Transcript >AgabiH97|086350
ATGTCGTTTCTGACGCCAAACGCGTTGAGGACCATGCCTTGGTCCTTGCTTCTACTCATACTATCGTCGACTTGG
GTTACTGCGCAGCGGAATCAATCCGTCCTTGATCGCCAGCTGGACAACGGGACTTCACTTCCGACCGCGTTGTCA
CTGGATTATGCGCTTGCGCCTGGAAGATGCCCACCTTGTTTCAATTGTCTGCTTCCGGCATTTACTTGCGGCCAA
TATGGACAGTGCAACAAGTTTAATGGCCAGTGTGAATGCCCTCCCGGCTGGTCCGGCATCGATTGTCTTACTCCT
CAGTGCGATTCCCTTGCGGATCGTGACCACCGAAGACCCAGAAGAGAAGGAGAATCATGCCAGTGCAAGGATGGC
TGGGGAGGCGTCAATTGCAATGTGTGTCAGAACGACAATGCTTGCGCCGGCTTTCCCATTCCTGAAGTTTCATCG
CTTCTTGACGGTGACAACGGCGGAAACATGACTTGTTATAAGGGTGGAGAAACGGTTTTCAGTAATCATCAAATG
TGCAATGTGACCAACAGAAAAATACTCGATATGCTTCCAGACCGTCCGCCACAAGTGACATTTAGCTGTGATCGT
CAAGACTCAACCTGTTCCTTCCAGTTCTGGACTGCAGAGGTCGAATCCTTCTATTGTGCGTTGGAGGGATGCACC
TCGGAAACACAGCCAGGTTACGACACGAATACAACAATATATGCATGTGATAAAATCAAATGTAGCTGCGTTACC
GGTCGTTTCTTATGTGGCGAGTCTGGTAGTATTGATATTGGCGATTTCTTGAAGGAAGAAATACGGGGTCCGGCT
CAGTTCAGCTGCAAGACTGGCAACGGCTGCAAGTTTGAAGAGCCGGCTATGAACGATCTCATCGACAGTGTATTT
GGTGATAGCTACATCACGTTGCAATGCGAGGGAGGAGAATGTCTTCATTACTCCCAAGTCCCAGGATATGTGCGA
CCCCCCAAACCGAGAAATAATCTCTGGCTTGCACTCAGTTCCTCGGGGGCGATCGTCATCGTGTTACTTTCTTCA
GCTGTCCTCTGGTATGCTGGTCGCATAGGGAAGGGGGGCGATTTTGGAAAGATCCGTCTTCCAGAGGCAGAAACT
GCGAAACTAATGTCGGACCATGTTCCTACTTCCCTCTATTTCTCTGGAATATCATATTCCCTTGGTGATCGTACC
ATCATCGACAATATATCAGGTAATGTCAAATCAGGGCAGGTCATGGCCATCATGGGAGCGTCTGGTGCAGGAAAG
TCGACCTTCCTTGACATTCTTGCACGCAAGAACAAGCGAGGTGTTGTTACTGGCTCCATGTTAGTGAATGGGCGG
GAGGTGAAGGACAGTGAATTCAAGAAGGTTGCGGGTTTTGTTGACCAAGAGGATACTTTGATGTCTACGTTGACT
GTCTACGAGACAGTCTTGTACAGCGCACTACTGAGGTTGCCGAGGGACATGAGTTTCGAGGCGAAAAAATTTCGG
ACCTTGGAGACCATGAATGAGCTAGGTATACTCGATATCAGGGATTCAAGAATCGGTGATTCTGGAACGCGTTCG
ATATCTGGGGGTGAAAAACGTCGTGTTTCAATTGCATGCGAGCTTGTCACAAGCCCGTCTATTTTGTTTTTGGAC
GAACCTACGAGTGGACTGGACTCCTTTAACGCATTCAACGTTGTTGAGTGCTTGGTTTCCCTTGCCCGCGATTAC
AACCGGACAGTTGTGTTCACTATCCATCAACCCCGTAGCAACATCGTCGCATTATTCGACCAACTTGTGGTTCTG
GGTGCCGGTAAACTAGTTTATTCTGGTGCATACTCAAAGTGCCCGGAATACTTTACATCGATCGGCTACCCTTGC
CCAACCGGGTTCAACATCGCCGATTATCTCATTGACCTGACGATGCAAGCTAGCATGGAACGCAAAGACAATGGG
AACAGCCGATCTAGCGTGCTTGCCTCATCTTCTGCTACGTCTCCAGCTGGCGATGAAGAACAAGGTCTTCCTGTA
GCTCCTCACTCCGCTGCCTTATCGGTTCGGTCCAACATATCCGCCAATGGTATACCAGAGGACACTGATGAATCT
GTTGTCTCCTCCACGGGCGATTATCTACGGAAGAAGACGTCCCAGATTGTCAATGCTGTCAGTTCTTTTGCTTCA
AATCGTGGCCCGGATGCTTCGATTACGCCGAAACTGGCTTCACTCGTACAGTCATATGTTGATAGCACGATAGCT
GCGGATATCAAAGCTGAGGGAGAAGAAATTGCTCGACAGGCGTCGCTGGCAACTACCCGTGATTCTGCGAGTAGG
CAACTGCCAGATGTTGCGGAGGAAACGTCATTGTTGCGTGGACGCAAGAGAGCATCTTGGGGTACTCAATTCAGA
ATTTTGAGTGGGAGAGCATTCAAGAACTTGTATCGTGACCCTGCGTTGCTGGCCGCCCATTACTTGTCCGCAATT
GGACTAGCAGTGCTTTGTGGACTGTTCTACCATAATATCACCAACGACATCGCTGGCTTCCAAAACCGTCTTGGA
CTCTTTTTTTTCACTTTAGCTCTATTTGGATTCTCTTGCTTGTCAAGTCTTGGTCTGTTTGCAAATGAGCGGATC
TTATTCATGCGCGAGCGCTCGAATGGTTACTACTCTACATTCACATACTTTTCATCGAAGATCTTATTCGATATC
CTCCCCCTCCGACTTGTTCCCCCTCTTATGTTTGGTGGTATCGTGTATGGCCTTGTTGGGCTTGTACCTACTGTC
GCCGGCTTTTGGAAGTTCCTACTTGCATTGGTCCTCTTTAACCTTACTACAGCGAGTGTTGTTTTACTGCTCTCT
ATCGTGTTTGACAGCATCAGCGTGGCGAGCTTGGTTGGAACATTGGTCATGCTGTTCAACCTTATGTTCACTGGT
TTACTCATCAACCGTGATACGGTTCCGGTGGCGTTCAGATGGCTGCACACGATCTCGTTCTTCCATGCCGCATTC
GAGTCTCTTGCTGTGAACGAGCTACGATACCTGCAATTGAAGGAAGTCAAGTATGGCGTCGAGTTGGATGTACCT
GCTGCAACTATTTTGTCGACTTTTGGACTTCGAGCCCAGTCGTATTGGTGGCCAAACATCTCGCTACTCGGAATT
TTCTTTGCTGTGTTTACTATTGGGAGCTTTATGTACCTGCATTTCTTTGTGAAGGAAAGGCGATAA
Gene >AgabiH97|086350
ATGTCGTTTCTGACGCCAAACGCGTTGAGGACCATGCCTTGGTCCTTGCTTCTACTCATACTATCGTCGACTTGG
GTTACTGCGCAGCGGAATCAATCCGTCCTTGATCGCCAGCTGGACAACGGGACTTCACTTCCGACCGTGAGTGGC
TGCGGAAACTTATGCCAGACCACTCATAACTATGCCTGCAGGCGTTGTCACTGGATTATGCGCTTGCGCCTGGTG
TGTATCTCGTTGCAAGAAGGTCTGATCATGCTCTGAATGTGTCTACGTCATCAGGAAGATGCCCACCTTGTTTCA
ATTGTCTGCTTCCGGCATTTACTTGCGGCCAATATGGACAGTGCAACAAGTTTAATGGCCAGTGTGAATGCCCTC
CCGGCTGGTCCGGCATCGATTGTCTTACTCCTCGTGTGCATTTTTCGCTTGTGTCTAACTTCGTAACTGATGTAG
CTTTTAGAGTGCGATTCCCTTGCGGATCGTGACCACCGAAGACCCAGAAGAGAAGGAGAATCATGCCAGTGCAAG
GATGGCTGGGGAGGCGTCAATTGCAATGGTGCGTTTTCGCATGAGTATCTCGTTATGCGTCAATTGATTCGCGAT
ATCAGTGTGTCAGAACGACAATGCTTGCGCCGGCTTTCCCATTCCTGAAGTTTCATCGCTTCTTGACGGTGACAA
CGGCGGAAACATGACTTGTTATAAGGGTGGAGAAACGGTTTTCAGTAATCATCAAATGTGCAATGTGACCAGTAT
GTCTGTTCCATTCCATGCATCTTCTCGCCTAAGCCCTCCGTCCAGACAGAAAAATACTCGATATGCTTCCAGACC
GTCCGCCACAAGTGACATTTAGCTGTGATCGTCAAGACTCAACCTGTTCCTTCCAGTTCTGGACTGCAGAGGTCG
AATCCTTCTATTGTGCGTTGGAGGGATGCACCTCGGAAACACAGCCAGGTTACGACACGAATACAACAATATATG
CATGTGATAAAATCAAATGTAGCTGCGTTACCGGTCGTTTCTTATGTGGCGAGTCTGGTAGTATTGGTGCGTAAT
AGGTTTTTCGATACACAGGTCATCGGTGACAACTCGCCCAGATATTGGCGATTTCTTGAAGGAAGAAATACGGGG
TCCGGCTCAGTTCAGCTGCAAGACTGGCAACGGCTGCAAGTTTGAAGAGCCGGCTATGAACGATCTCATCGACAG
TGTATTTGGTGATAGCTACATCACGTTGCAATGCGAGGGAGGAGAATGTCTTCATTACTCCCAAGTCCCAGGATA
TGTGGTAAGTCTGGACGTTGAGTGACAATAAAGTGAAGGCGCTCATGGCCGGTAGCGACCCCCCAAACCGAGAAA
TAATCTCTGGCTTGCACTCAGTTCCTCGGGGGCGATCGTCATCGTGTTACTTTCTTCAGCTGGTCAGTGGTTCGC
AATCAAGTATACAGCGTTTATATTGAATACCCCACGTAGTCCTCTGGTATGCTGGTCGCATAGGGAAGGGGGGCG
ATTTTGGAAAGATCCGTCTTCCAGAGGCAGAAACTGCGAAACTAATGTCGGACCATGTTCCTACTTCCCTCTATT
TCTCTGGAATATCATATTCCCTTGGTGATCGTACCATCATCGACAATATATCAGGTAATGTCAAATCAGGGCAGG
TCATGGCCATCATGGGAGCGTCTGGTGCAGGAAAGTCGACCTTCCTTGACATTCTTGCACGCAAGAACAAGCGAG
GTGTTGTTACTGGCTCCATGTTAGTGAATGGGCGGGAGGTGAAGGACAGTGAATTCAAGAAGGTTGCGGGTTTTG
TTGACCAAGAGGATACTTTGATGTCTACGTTGACTGTCTACGAGACAGTCTTGTACAGCGCACTACTGAGGTTGC
CGAGGGACATGAGTTTCGAGGCGAAAAAATTTCGGACCTTGGAGACCATGAATGAGCTAGGTATACTCGATATCA
GGGATTCAAGAATCGGTGATTCTGGTATGTGTTATATCCTGACTACGATGCGCATCTCATCCCGCGGTTTTAGGA
ACGCGTTCGATATCTGGGGGTGAAAAACGTCGTGTTTCAATTGCATGCGAGCTTGTCACAAGCCCGTCTATTTTG
TTTTTGGACGAACCTACGAGTGGTGAGTAATCTTTCCGGCTCTTGCGACACTTGATCGGTTGGTGACTCTCCGCA
GGACTGGACTCCTTTAACGCATTCAACGTTGTTGAGTGCTTGGTTTCCCTTGCCCGCGATTACAACCGGACAGTT
GTGTTCACTATCCATCAACCCCGTAGCAACATCGTCGCATTATTCGACCAACTTGTGGTTCTGGGTGCCGGTAAA
CTAGTTTATTCTGGTGCATACTCAAAGTGCCCGGAATACTTTACATCGATCGGCTACCCTTGCCCAACCGGGTTC
AACATCGCCGATTATCTCAGTGAGTGATCGCGTGAATCTACGATACAGAAAACTCAACAGTTTTAAAGTTGACCT
GACGATGCAAGCTAGCATGGAACGCAAAGACAATGGGAACAGCCGATCTAGCGTGCTTGCCTCATCTTCTGCTAC
GTCTCCAGCTGGCGATGAAGAACAAGGTCTTCCTGTAGCTCCTCACTCCGCTGCCTTATCGGTTCGGTCCAACAT
ATCCGCCAATGGTATACCAGAGGACACTGATGAATCTGTTGTCTCCTCCACGGGCGATTATCTACGGAAGAAGAC
GTCCCAGATTGTCAATGCTGTCAGTTCTTTTGCTTCAAATCGTGGCCCGGATGCTTCGATTACGCCGAAACTGGC
TTCACTCGTACAGTCATATGTTGATAGCACGATAGCTGCGGATATCAAAGCTGAGGGAGAAGAAATTGCTCGACA
GGCGTCGCTGGCAACTACCCGTGATTCTGCGAGTAGGCAACTGCCAGATGTTGCGGAGGAAACGTCATTGTTGCG
TGGACGCAAGAGAGCATCTTGGGGTACTCAATTCAGAATTTTGAGTGGGAGAGCATTCAAGAACTTGTATCGTGA
CCCTGCGTTGCTGGCCGCCCATTACTTGTCCGCAATTGGACTAGCAGGTGAGTGTTTGCGTGGAGTTGATGATGG
CTTGACTGATCATGGGCCGTCTTTTTGCGACTACAGTGCTTTGTGGACTGTTCTACCATAATATCACGTAGGTGT
TGTCATTTGTTGCTTGACCATCATTTCTCAGGAAGATCCTAGCAACGACATCGCTGGCTTCCAAAACCGTCTTGG
ACTCTTTTTTTTCACTTTAGCTCTATTTGGATTCTCTTGCTTGTCAAGTCTTGGTCTGTTTGCAAATGAGCGGAT
CTTATTCATGCGCGAGCGGTAGGTGGTGATGATATGATTGTCGTGTATGTGGTCTTGAGCTGAGTTCACAGCTCG
AATGGTTACTACTCTACATTCACATACTTTTCATCGAAGGTGATTGTTTCGCGGCGCCGCGGCTACTTGTCGGCT
AATCATGAGAAACATAGATCTTATTCGATATCCTCCCCCTCCGACTTGTTCCCCCTCTTATGTTTGGTGGTATCG
TGTATGGCCTTGTTGGGCTTGTACCTACTGTCGCCGGCTTTTGGAAGTTCCTACTTGCATTGGTCCTCTTTAACC
TTACTACAGCGAGTGTTGTTTTACTGCTCTCTATCGTGTTTGACAGCATCAGCGTGGCGAGCTTGGTTGGAACAT
TGGTCATGCTGTTCAAGTAAGTTGCCGGTTTCCGCTGCATGAATATAGGTATCCTGAAGATCGGTGATCGCCTAG
CCTTATGTTCACTGGTTTACTCATCAACCGTGATACGGTTCCGGTGGCGTTCAGATGGCTGCACACGATCTCGTT
CTTCCATGCCGCATTCGAGTCTCTTGCTGTGAACGAGCTACGATACCTGCAATTGAAGGAAGTCAAGTATGGCGT
CGAGTTGGATGTACCTGCTGCAACTATTTTGTCGACTTTTGGACTTCGAGCCCAGGTGAGTGTTTCGACTTTGCT
CTGACTAGATGTTAAAGTGCCCTTAGTCGTATTGGTGGCCAAACATCTCGCTACTCGGAATTTTCTTTGCTGTGT
TTACTATTGGGAGCTTTATGTACCTGCATTTCTTTGTGAAGGAAAGGCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail