Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|086150
Gene name
Locationscaffold_5:1968489..1969616
Strand+
Gene length (bp)1127
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A 3.9E-15 185 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 10 278 6.0E-65
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 1 278 6.0E-65
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 34 278 9.0E-65
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 16 278 2.0E-64
sp|C9S5C6|MEP1_VERA1 Extracellular metalloprotease VDBG_01143 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01143 PE=3 SV=1 1 278 8.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 10 278 6.0E-65
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 1 278 6.0E-65
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 34 278 9.0E-65
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 16 278 2.0E-64
sp|C9S5C6|MEP1_VERA1 Extracellular metalloprotease VDBG_01143 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01143 PE=3 SV=1 1 278 8.0E-62
sp|Q871C5|MEP1_NEUCR Extracellular metalloprotease NCU07200 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8G12.220 PE=3 SV=1 59 278 1.0E-60
sp|E3QKH9|MEP2_COLGM Extracellular metalloprotease GLRG_06511 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06511 PE=3 SV=1 6 281 2.0E-58
sp|C4K014|MEP1_UNCRE Extracellular metalloprotease UREG_07765 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07765 PE=3 SV=1 1 278 6.0E-58
sp|E3QJV4|MEP1_COLGM Extracellular metalloprotease GLRG_06286 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06286 PE=3 SV=1 54 278 1.0E-57
sp|D4DIV0|MEP7_TRIVH Extracellular metalloprotease TRV_07111 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_07111 PE=3 SV=1 7 278 1.0E-55
sp|D4ATD1|MEP7_ARTBC Extracellular metalloprotease ARB_07495 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07495 PE=3 SV=1 7 278 1.0E-55
sp|C5FQJ4|MEP6_ARTOC Extracellular metalloprotease MCYG_04966 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04966 PE=3 SV=1 2 278 2.0E-53
sp|C9SSK8|MEP2_VERA1 Extracellular metalloprotease VDBG_07883 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_07883 PE=3 SV=1 2 278 4.0E-52
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 7 278 7.0E-52
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 7 278 8.0E-52
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 7 278 9.0E-52
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 2 278 2.0E-50
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 50 278 2.0E-49
sp|C5FL47|MEP7_ARTOC Extracellular metalloprotease MCYG_03238 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03238 PE=3 SV=1 7 278 8.0E-47
sp|Q2UBF0|MEP1_ASPOR Extracellular metalloprotease AO090012001025 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090012001025 PE=3 SV=1 47 278 3.0E-38
sp|Q4WJ01|MEP1_ASPFU Extracellular metalloprotease AFUA_1G07730 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G07730 PE=3 SV=2 52 278 4.0E-37
sp|B0XPZ1|MEP1_ASPFC Extracellular metalloprotease AFUB_008060 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_008060 PE=3 SV=2 52 278 5.0E-37
sp|Q8TL28|ULIL_METAC Ulilysin OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_3214 PE=1 SV=1 76 282 8.0E-24
sp|Q9BXP8|PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens GN=PAPPA2 PE=1 SV=4 126 271 2.0E-10
sp|Q8R4K8|PAPP1_MOUSE Pappalysin-1 OS=Mus musculus GN=Pappa PE=2 SV=2 126 274 5.0E-09
sp|Q13219|PAPP1_HUMAN Pappalysin-1 OS=Homo sapiens GN=PAPPA PE=1 SV=3 126 274 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 119.78 53.57 185.98
Initials Initials knots 38.94 21.22 56.65
Pileal_Stipeal_center Stage I stipe center 11.03 5.06 17.00
Pileal_Stipeal_shell Stage I stipe shell 13.06 6.09 20.04
DIF_stipe_center Stage II stipe center 9.56 4.30 14.82
DIF_stipe_shell Stage II stipe shell 8.52 3.68 13.35
DIF_stipe_skin Stage II stipe skin 10.16 4.61 15.72
DIF_cap_skin Stage II cap skin 11.83 5.45 18.22
DIF_cap_tissue Stage II cap tissue 11.51 5.30 17.72
DIF_gill_tissue Stage II gill tissue 13.43 6.35 20.50
YFB_stipe_center Young fruiting body stipe center 9.34 4.19 14.50
YFB_stipe_shell Young fruiting body stipe shell 8.02 3.50 12.53
YFB_stipe_skin Young fruiting body stipe skin 7.40 3.15 11.64
YFB_cap_skin Young fruiting body cap skin 12.24 5.64 18.84
YFB_cap_tissue Young fruiting body cap tissue 11.29 5.04 17.54
YFB_gill_tissue Young fruiting body gill tissue 11.14 5.13 17.16
YFB_veil Young fruiting body veil 11.76 5.40 18.11

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.406363 no
DIF_gill_tissue YFB_stipe_shell 0.201976 no
DIF_gill_tissue YFB_stipe_skin 0.123509 no
DIF_gill_tissue YFB_cap_skin 0.887184 no
DIF_gill_tissue YFB_cap_tissue 0.761705 no
DIF_gill_tissue YFB_gill_tissue 0.735645 no
DIF_gill_tissue YFB_veil 0.827356 no
YFB_stipe_center YFB_stipe_shell 0.808198 no
YFB_stipe_center YFB_stipe_skin 0.670585 no
YFB_stipe_center YFB_cap_skin 0.595881 no
YFB_stipe_center YFB_cap_tissue 0.741355 no
YFB_stipe_center YFB_gill_tissue 0.761465 no
YFB_stipe_center YFB_veil 0.672072 no
YFB_stipe_shell YFB_stipe_skin 0.914035 no
YFB_stipe_shell YFB_cap_skin 0.345288 no
YFB_stipe_shell YFB_cap_tissue 0.478597 no
YFB_stipe_shell YFB_gill_tissue 0.498538 no
YFB_stipe_shell YFB_veil 0.410474 no
YFB_stipe_skin YFB_cap_skin 0.230353 no
YFB_stipe_skin YFB_cap_tissue 0.343969 no
YFB_stipe_skin YFB_gill_tissue 0.361624 no
YFB_stipe_skin YFB_veil 0.282996 no
YFB_cap_skin YFB_cap_tissue 0.908823 no
YFB_cap_skin YFB_gill_tissue 0.891989 no
YFB_cap_skin YFB_veil 0.956845 no
YFB_cap_tissue YFB_gill_tissue 0.986319 no
YFB_cap_tissue YFB_veil 0.956407 no
YFB_gill_tissue YFB_veil 0.940881 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.001625 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.725081 no
Pileal_Stipeal_center YFB_stipe_center 0.782113 no
Pileal_Stipeal_center YFB_stipe_shell 0.525539 no
Pileal_Stipeal_center YFB_stipe_skin 0.385213 no
Pileal_Stipeal_center YFB_cap_skin 0.876695 no
Pileal_Stipeal_center YFB_cap_tissue 0.974859 no
Pileal_Stipeal_center YFB_gill_tissue 0.988565 no
Pileal_Stipeal_center YFB_veil 0.930920 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.780512 no
Pileal_Stipeal_center DIF_stipe_center 0.819731 no
Pileal_Stipeal_center DIF_stipe_shell 0.632917 no
Pileal_Stipeal_center DIF_stipe_skin 0.908478 no
Pileal_Stipeal_center DIF_cap_skin 0.923670 no
Pileal_Stipeal_center DIF_cap_tissue 0.954155 no
Pileal_Stipeal_shell DIF_gill_tissue 0.971243 no
Pileal_Stipeal_shell YFB_stipe_center 0.468133 no
Pileal_Stipeal_shell YFB_stipe_shell 0.243944 no
Pileal_Stipeal_shell YFB_stipe_skin 0.155441 no
Pileal_Stipeal_shell YFB_cap_skin 0.927487 no
Pileal_Stipeal_shell YFB_cap_tissue 0.813591 no
Pileal_Stipeal_shell YFB_gill_tissue 0.791443 no
Pileal_Stipeal_shell YFB_veil 0.873878 no
Pileal_Stipeal_shell DIF_stipe_center 0.512779 no
Pileal_Stipeal_shell DIF_stipe_shell 0.336775 no
Pileal_Stipeal_shell DIF_stipe_skin 0.632488 no
Pileal_Stipeal_shell DIF_cap_skin 0.884202 no
Pileal_Stipeal_shell DIF_cap_tissue 0.842165 no
DIF_stipe_center DIF_gill_tissue 0.450593 no
DIF_stipe_center YFB_stipe_center 0.975263 no
DIF_stipe_center YFB_stipe_shell 0.771008 no
DIF_stipe_center YFB_stipe_skin 0.629215 no
DIF_stipe_center YFB_cap_skin 0.637732 no
DIF_stipe_center YFB_cap_tissue 0.780478 no
DIF_stipe_center YFB_gill_tissue 0.800839 no
DIF_stipe_center YFB_veil 0.711374 no
DIF_stipe_center DIF_stipe_shell 0.864045 no
DIF_stipe_center DIF_stipe_skin 0.934016 no
DIF_stipe_center DIF_cap_skin 0.699037 no
DIF_stipe_center DIF_cap_tissue 0.748637 no
DIF_stipe_shell DIF_gill_tissue 0.285035 no
DIF_stipe_shell YFB_stipe_center 0.896172 no
DIF_stipe_shell YFB_stipe_shell 0.938304 no
DIF_stipe_shell YFB_stipe_skin 0.831235 no
DIF_stipe_shell YFB_cap_skin 0.449506 no
DIF_stipe_shell YFB_cap_tissue 0.588916 no
DIF_stipe_shell YFB_gill_tissue 0.609752 no
DIF_stipe_shell YFB_veil 0.518857 no
DIF_stipe_shell DIF_stipe_skin 0.776711 no
DIF_stipe_shell DIF_cap_skin 0.508742 no
DIF_stipe_shell DIF_cap_tissue 0.557706 no
DIF_stipe_skin DIF_gill_tissue 0.565027 no
DIF_stipe_skin YFB_stipe_center 0.903904 no
DIF_stipe_skin YFB_stipe_shell 0.665656 no
DIF_stipe_skin YFB_stipe_skin 0.521216 no
DIF_stipe_skin YFB_cap_skin 0.747944 no
DIF_stipe_skin YFB_cap_tissue 0.875557 no
DIF_stipe_skin YFB_gill_tissue 0.893575 no
DIF_stipe_skin YFB_veil 0.814082 no
DIF_stipe_skin DIF_cap_skin 0.804175 no
DIF_stipe_skin DIF_cap_tissue 0.847048 no
DIF_cap_skin DIF_gill_tissue 0.839495 no
DIF_cap_skin YFB_stipe_center 0.652922 no
DIF_cap_skin YFB_stipe_shell 0.399990 no
DIF_cap_skin YFB_stipe_skin 0.273750 no
DIF_cap_skin YFB_cap_skin 0.964497 no
DIF_cap_skin YFB_cap_tissue 0.949162 no
DIF_cap_skin YFB_gill_tissue 0.934697 no
DIF_cap_skin YFB_veil 0.991693 no
DIF_cap_skin DIF_cap_tissue 0.969819 no
DIF_cap_tissue DIF_gill_tissue 0.797075 no
DIF_cap_tissue YFB_stipe_center 0.709513 no
DIF_cap_tissue YFB_stipe_shell 0.449066 no
DIF_cap_tissue YFB_stipe_skin 0.311175 no
DIF_cap_tissue YFB_cap_skin 0.932632 no
DIF_cap_tissue YFB_cap_tissue 0.978965 no
DIF_cap_tissue YFB_gill_tissue 0.964889 no
DIF_cap_tissue YFB_veil 0.976976 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|086150
MFKSAFFCVLLAASAAFASPSARRLCGNELTDDEVAVLEADFAAKKVDVSANRALAATIPVHFHVIQESTALSGG
NVPNSQLTAQINVLNDAYSGSGLSFSLASIDHTTNANWFRSVGPGTSGEADMKQSLRTGGANALNVYTVGFESGA
GAGLLGYATFPSSFSRNPTDDGVVMLYSSLPGGSAAPFNLGGTLIHEAGHWVGLFHTFQGGCSASGDSVSDTPPE
AEPNFGCPSSRDSCSGGGTDPIHNYMDYSDDICYTEFTAGQIARLQSQMATFRGVFV*
Coding >AgabiH97|086150
ATGTTCAAGTCTGCTTTCTTCTGTGTTCTGCTCGCTGCCTCCGCCGCTTTTGCTTCTCCTAGTGCTCGCAGGCTT
TGCGGCAACGAGCTGACTGATGATGAAGTCGCTGTTCTTGAGGCAGACTTTGCGGCCAAGAAGGTTGACGTTTCC
GCAAACAGAGCCCTGGCTGCTACCATTCCTGTGCACTTCCACGTCATCCAGGAGAGTACAGCCCTCAGTGGGGGA
AACGTTCCTAATTCACAGCTCACTGCTCAAATCAACGTTTTGAACGACGCTTATTCTGGATCTGGCTTGAGCTTC
TCGCTTGCTAGCATTGATCATACCACAAATGCCAATTGGTTCAGATCAGTTGGTCCGGGTACCAGTGGAGAAGCT
GACATGAAGCAGTCTCTCCGTACCGGTGGAGCTAATGCTCTGAACGTTTACACCGTTGGCTTCGAGTCTGGAGCT
GGTGCAGGTCTTTTGGGATATGCTACTTTCCCCTCGAGCTTCTCTAGAAACCCTACTGATGATGGTGTGGTCATG
CTCTACTCCTCCCTTCCCGGTGGCAGCGCCGCTCCCTTCAACCTCGGTGGGACTCTCATTCACGAAGCTGGTCAC
TGGGTCGGCCTCTTCCACACTTTCCAGGGTGGCTGCTCTGCTTCAGGAGACTCTGTCTCTGACACTCCCCCTGAG
GCTGAGCCCAACTTTGGTTGCCCCAGCAGCCGTGACTCCTGCTCTGGTGGCGGAACTGACCCCATCCACAACTAC
ATGGACTACAGTGACGATATCTGCTACACTGAATTCACTGCGGGACAGATCGCACGCTTACAATCACAAATGGCC
ACTTTCCGTGGTGTCTTTGTTTAA
Transcript >AgabiH97|086150
ATGTTCAAGTCTGCTTTCTTCTGTGTTCTGCTCGCTGCCTCCGCCGCTTTTGCTTCTCCTAGTGCTCGCAGGCTT
TGCGGCAACGAGCTGACTGATGATGAAGTCGCTGTTCTTGAGGCAGACTTTGCGGCCAAGAAGGTTGACGTTTCC
GCAAACAGAGCCCTGGCTGCTACCATTCCTGTGCACTTCCACGTCATCCAGGAGAGTACAGCCCTCAGTGGGGGA
AACGTTCCTAATTCACAGCTCACTGCTCAAATCAACGTTTTGAACGACGCTTATTCTGGATCTGGCTTGAGCTTC
TCGCTTGCTAGCATTGATCATACCACAAATGCCAATTGGTTCAGATCAGTTGGTCCGGGTACCAGTGGAGAAGCT
GACATGAAGCAGTCTCTCCGTACCGGTGGAGCTAATGCTCTGAACGTTTACACCGTTGGCTTCGAGTCTGGAGCT
GGTGCAGGTCTTTTGGGATATGCTACTTTCCCCTCGAGCTTCTCTAGAAACCCTACTGATGATGGTGTGGTCATG
CTCTACTCCTCCCTTCCCGGTGGCAGCGCCGCTCCCTTCAACCTCGGTGGGACTCTCATTCACGAAGCTGGTCAC
TGGGTCGGCCTCTTCCACACTTTCCAGGGTGGCTGCTCTGCTTCAGGAGACTCTGTCTCTGACACTCCCCCTGAG
GCTGAGCCCAACTTTGGTTGCCCCAGCAGCCGTGACTCCTGCTCTGGTGGCGGAACTGACCCCATCCACAACTAC
ATGGACTACAGTGACGATATCTGCTACACTGAATTCACTGCGGGACAGATCGCACGCTTACAATCACAAATGGCC
ACTTTCCGTGGTGTCTTTGTTTAA
Gene >AgabiH97|086150
ATGTTCAAGTCTGCTTTCTTCTGTGTTCTGCTCGCTGCCTCCGCCGCTTTTGCTTCTCCTAGTGCTCGCAGGTTT
GTACAGTTTTGCGTGCTAGAACGATGGGCTTATGATTGACCGATTCTTACCGATTGAACAGGCTTTGCGGCAACG
AGCTGACTGATGATGAAGTCGCTGTTCTTGAGGCAGACTTTGCGGCCAAGAAGGTTGACGTTTCCGCAAACAGAG
CCCTGGCTGCTACCATTCCTGTGCACTTCCACGTCATCCAGGAGAGTACAGCCCTCAGTGGGGGAAACGTTCCGT
ACGTATCATTAGGAATTTCCTAGTTCGTTGTCTAACTTTGAACAAAGTAATTCACAGCTCACTGCTCAAATCAAC
GTTTTGAACGACGCTTATTCTGGATCTGGCTTGAGCTTCTCGCTTGCTAGCATTGATCATACCACAAATGCCAAT
TGGTTCAGATCAGTTGGTCCGGGTACCAGTGGAGAAGCTGACATGAAGCAGTCTCTCCGTACCGGTGGAGCTAAT
GCTCTGAACGTTTACACCGTTGGGTAAGTGAACGTTGTTCAGCATCAGTTCTGATGTTAACCCTTGTTTTCGAAT
ATAGCTTCGAGTCTGGAGCTGGTGCAGGTCTTTTGGGATATGCTACTTTCCCCTCGAGCTTCTCTAGAAACCCTA
CTGATGATGGTGTGGTCATGCTCTACTCCTCCCTTCCCGGTGGCAGCGCCGCTCCCTTCAACCTCGGTGGGGTAA
GGATCTACACGTTGCTTGCACGAAATGTATCTAAAATATTTCTTAGACTCTCATTCACGAAGCTGGTCACTGGGT
CGGCCTCTTCCACACTTTCCAGGGTGGCTGCTCTGCTTCAGGAGACTCTGTCTCTGACACTCCCCCTGAGGCTGA
GCCCAACTTTGGTTGCCCCAGCAGCCGTGACTCCTGCTCTGGTGGCGGAACTGACCCCATCCGTAAGTTTTTACT
ACCTCGTTTGAATATGGGACTTGGGCTCAAAGTTTGTTAATCTAGACAACTACATGGACTACAGTGACGATATCT
GCTACACTGAATTCACTGCGGGACAGATCGCACGCTTACAATCACAAATGGCCACTTTCCGTGGTGTCTTTGTTT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail