Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|086040
Gene name
Locationscaffold_5:1944933..1947121
Strand-
Gene length (bp)2188
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.4E-37 110 372
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.1E-10 112 371
PF12146 Hydrolase_4 Serine aminopeptidase, S33 7.6E-09 133 371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P93732|PIP_ARATH Proline iminopeptidase OS=Arabidopsis thaliana GN=PIP PE=2 SV=3 80 391 1.0E-125
sp|O83041|PIP_LEPBY Probable proline iminopeptidase OS=Leptolyngbya boryana GN=pip PE=3 SV=1 80 389 7.0E-120
sp|Q9PD69|PIP_XYLFA Proline iminopeptidase OS=Xylella fastidiosa (strain 9a5c) GN=pip PE=3 SV=1 80 388 1.0E-115
sp|Q87DF8|PIP_XYLFT Proline iminopeptidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pip PE=3 SV=1 80 388 3.0E-114
sp|P52279|PIP_XANCI Proline iminopeptidase OS=Xanthomonas citri GN=pip PE=1 SV=2 80 389 2.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P93732|PIP_ARATH Proline iminopeptidase OS=Arabidopsis thaliana GN=PIP PE=2 SV=3 80 391 1.0E-125
sp|O83041|PIP_LEPBY Probable proline iminopeptidase OS=Leptolyngbya boryana GN=pip PE=3 SV=1 80 389 7.0E-120
sp|Q9PD69|PIP_XYLFA Proline iminopeptidase OS=Xylella fastidiosa (strain 9a5c) GN=pip PE=3 SV=1 80 388 1.0E-115
sp|Q87DF8|PIP_XYLFT Proline iminopeptidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pip PE=3 SV=1 80 388 3.0E-114
sp|P52279|PIP_XANCI Proline iminopeptidase OS=Xanthomonas citri GN=pip PE=1 SV=2 80 389 2.0E-109
sp|O32449|PIP_SERMA Proline iminopeptidase OS=Serratia marcescens GN=pip PE=1 SV=1 80 389 4.0E-105
sp|Q9JZR6|PIP_NEIMB Proline iminopeptidase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pip PE=3 SV=1 80 386 6.0E-99
sp|Q9JUV1|PIP_NEIMA Proline iminopeptidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pip PE=3 SV=1 80 386 1.0E-98
sp|P42786|PIP_NEIGO Proline iminopeptidase OS=Neisseria gonorrhoeae GN=pip PE=1 SV=1 80 386 2.0E-98
sp|Q9S2L4|PIP_STRCO Probable proline iminopeptidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1989 PE=3 SV=1 80 389 4.0E-68
sp|P47266|PIP_MYCGE Putative proline iminopeptidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pip PE=3 SV=1 89 378 2.0E-56
sp|P75092|PIP_MYCPN Putative proline iminopeptidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pip PE=3 SV=1 85 378 5.0E-56
sp|C0ZKI1|PIP_BREBN Proline iminopeptidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pip PE=3 SV=1 99 370 1.0E-15
sp|P46541|PIP_BACCO Proline iminopeptidase OS=Bacillus coagulans GN=pip PE=1 SV=2 86 370 9.0E-14
sp|Q890D8|PIP_LACPL Proline iminopeptidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pip PE=3 SV=2 100 372 9.0E-12
sp|B0SW62|RUTD_CAUSK Putative aminoacrylate hydrolase RutD OS=Caulobacter sp. (strain K31) GN=rutD PE=3 SV=1 91 207 3.0E-11
sp|A8YWL3|PIP_LACH4 Proline iminopeptidase OS=Lactobacillus helveticus (strain DPC 4571) GN=pip PE=3 SV=1 100 203 1.0E-10
sp|P52278|PIP_LACHE Proline iminopeptidase OS=Lactobacillus helveticus GN=pip PE=1 SV=1 100 203 1.0E-10
sp|D5H0J3|PIP_LACCS Proline iminopeptidase OS=Lactobacillus crispatus (strain ST1) GN=pip PE=3 SV=1 100 199 2.0E-10
sp|P46544|PIP_LACDE Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pepIP PE=1 SV=2 111 370 4.0E-10
sp|Q1G8L9|PIP_LACDA Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pepIP PE=3 SV=1 111 370 4.0E-10
sp|A5I3F5|PIP_CLOBH Proline iminopeptidase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pip PE=3 SV=1 97 207 2.0E-09
sp|Q5FMT1|PIP_LACAC Proline iminopeptidase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pip PE=3 SV=1 100 203 2.0E-09
sp|P46542|PIP_LACDL Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pip PE=1 SV=1 111 370 9.0E-09
sp|Q184M8|PIP_PEPD6 Proline iminopeptidase OS=Peptoclostridium difficile (strain 630) GN=pip PE=3 SV=1 100 215 2.0E-08
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 99 207 2.0E-07
sp|P23133|TODF_PSEP1 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todF PE=3 SV=2 109 370 3.0E-07
sp|C7TMK0|PIP_LACRL Proline iminopeptidase OS=Lactobacillus rhamnosus (strain Lc 705) GN=pip PE=3 SV=1 80 372 3.0E-07
sp|D5VGV3|RUTD_CAUST Putative aminoacrylate hydrolase RutD OS=Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) GN=rutD PE=3 SV=1 91 207 6.0E-07
sp|A1JMX1|RUTD_YERE8 Putative aminoacrylate hydrolase RutD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rutD PE=3 SV=1 99 206 1.0E-06
sp|C7PDD8|PIP_CHIPD Proline iminopeptidase OS=Chitinophaga pinensis (strain ATCC 43595 / DSM 2588 / NCIB 11800 / UQM 2034) GN=Cpin_0261 PE=3 SV=2 105 233 1.0E-06
sp|Q03NE0|PIP_LACBA Proline iminopeptidase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pip PE=3 SV=1 80 207 2.0E-06
sp|Q4ZXS0|RUTD_PSEU2 Putative aminoacrylate hydrolase RutD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rutD PE=3 SV=1 99 372 2.0E-06
sp|D5CE35|RUTD_ENTCC Putative aminoacrylate hydrolase RutD OS=Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56) GN=rutD PE=3 SV=1 108 236 2.0E-06
sp|A4W922|RUTD_ENT38 Putative aminoacrylate hydrolase RutD OS=Enterobacter sp. (strain 638) GN=rutD PE=3 SV=1 111 270 5.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6686 0.5613 0.2666 0.1883 0.3411 0.0784 0.1726 0.1042 0.1453 0.0306

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup1300
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|085240
Agaricus bisporus var bisporus H39 AgabiH39|086040
Agaricus bisporus var bisporus H39 AgabiH39|086060
Agaricus bisporus var bisporus H97 AgabiH97|085240
Agaricus bisporus var bisporus H97 AgabiH97|086040 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|086060
Rhodonia placenta FPRL280 RhoplFPRL280|54_26

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|086040
MKVVLGDMMGYWIMATNWKGDGGVVLNFLDYSALSVSHKSHAGGTICPGPDDSFGRVAFSRVHDNRFSYYPISKQ
AGMSYQPIEPYETGTLKVSDIHTLYYEISGNKEGNPVVFLHGGPGGGTNPGDRTFFNPDKYKIILFDQRGTGKST
PRGCLEENTTWDLVDDIERLRERLGIEKWHVFGGSWGSTLSLAYAQSHPNRVKSLVIRGVCTLRKSEMQFQIQNG
TCHLFPEAWDEFVAPIPESERDDLISAYHKRLNSDDEATRKAAAKSWVRWEMSISKLYIDPNLIALADDDYFADA
FARIIAHYSVNEGFMRDGQLLEKDSVDKIRHIPTVMIQGRYDVACPPATAYALKKVFPEATLHIVPDAGHSAREP
GTLKLLMEATNKFADL*
Coding >AgabiH97|086040
ATGAAAGTGGTGTTGGGTGATATGATGGGTTATTGGATTATGGCGACGAATTGGAAGGGAGATGGGGGAGTTGTA
TTAAATTTTCTAGATTACAGCGCCTTGTCAGTATCACATAAGTCTCATGCGGGCGGCACTATTTGTCCTGGGCCG
GATGACTCATTTGGCCGCGTAGCCTTCTCCAGAGTCCACGACAACAGGTTCTCATATTATCCAATAAGTAAGCAA
GCAGGTATGTCGTACCAGCCTATCGAACCCTATGAAACGGGCACCCTCAAGGTCTCCGACATCCACACCCTCTAT
TACGAAATTTCTGGTAATAAGGAAGGGAATCCAGTGGTCTTCCTCCACGGTGGCCCTGGAGGAGGGACCAACCCG
GGTGATCGTACTTTCTTCAACCCTGACAAATACAAGATTATCCTTTTCGACCAACGAGGCACGGGAAAGTCTACT
CCAAGAGGATGCTTGGAAGAGAATACTACATGGGATCTTGTGGACGATATTGAAAGGCTGAGAGAGAGGTTGGGT
ATTGAAAAATGGCATGTTTTTGGTGGATCTTGGGGATCCACGCTTTCATTGGCGTATGCCCAGTCTCACCCTAAT
CGAGTCAAGTCTCTTGTCATACGTGGCGTTTGCACTCTACGCAAGAGTGAAATGCAGTTTCAGATTCAAAACGGA
ACTTGCCATCTCTTCCCAGAAGCATGGGATGAATTTGTGGCGCCCATTCCAGAGTCCGAGCGAGATGATCTTATC
TCTGCCTACCACAAGCGACTTAACTCGGATGATGAGGCCACCCGTAAGGCTGCGGCTAAATCATGGGTGAGATGG
GAGATGTCGATTTCGAAGCTATATATTGATCCGAATTTGATCGCACTAGCCGATGATGATTATTTCGCCGACGCT
TTCGCTCGAATCATAGCCCACTATTCTGTAAATGAGGGTTTCATGAGGGATGGACAATTGCTTGAGAAGGATTCT
GTTGATAAGATCCGCCATATTCCTACTGTTATGATCCAGGGGCGGTACGACGTTGCCTGTCCACCTGCAACCGCG
TATGCATTAAAAAAGGTATTCCCTGAAGCGACCTTGCATATCGTTCCCGATGCTGGTCATTCTGCACGCGAGCCT
GGTACTTTAAAGCTTCTTATGGAGGCTACAAACAAATTTGCAGATCTTTAG
Transcript >AgabiH97|086040
ATGAAAGTGGTGTTGGGTGATATGATGGGTTATTGGATTATGGCGACGAATTGGAAGGGAGATGGGGGAGTTGTA
TTAAATTTTCTAGATTACAGCGCCTTGTCAGTATCACATAAGTCTCATGCGGGCGGCACTATTTGTCCTGGGCCG
GATGACTCATTTGGCCGCGTAGCCTTCTCCAGAGTCCACGACAACAGGTTCTCATATTATCCAATAAGTAAGCAA
GCAGGTATGTCGTACCAGCCTATCGAACCCTATGAAACGGGCACCCTCAAGGTCTCCGACATCCACACCCTCTAT
TACGAAATTTCTGGTAATAAGGAAGGGAATCCAGTGGTCTTCCTCCACGGTGGCCCTGGAGGAGGGACCAACCCG
GGTGATCGTACTTTCTTCAACCCTGACAAATACAAGATTATCCTTTTCGACCAACGAGGCACGGGAAAGTCTACT
CCAAGAGGATGCTTGGAAGAGAATACTACATGGGATCTTGTGGACGATATTGAAAGGCTGAGAGAGAGGTTGGGT
ATTGAAAAATGGCATGTTTTTGGTGGATCTTGGGGATCCACGCTTTCATTGGCGTATGCCCAGTCTCACCCTAAT
CGAGTCAAGTCTCTTGTCATACGTGGCGTTTGCACTCTACGCAAGAGTGAAATGCAGTTTCAGATTCAAAACGGA
ACTTGCCATCTCTTCCCAGAAGCATGGGATGAATTTGTGGCGCCCATTCCAGAGTCCGAGCGAGATGATCTTATC
TCTGCCTACCACAAGCGACTTAACTCGGATGATGAGGCCACCCGTAAGGCTGCGGCTAAATCATGGGTGAGATGG
GAGATGTCGATTTCGAAGCTATATATTGATCCGAATTTGATCGCACTAGCCGATGATGATTATTTCGCCGACGCT
TTCGCTCGAATCATAGCCCACTATTCTGTAAATGAGGGTTTCATGAGGGATGGACAATTGCTTGAGAAGGATTCT
GTTGATAAGATCCGCCATATTCCTACTGTTATGATCCAGGGGCGGTACGACGTTGCCTGTCCACCTGCAACCGCG
TATGCATTAAAAAAGGTATTCCCTGAAGCGACCTTGCATATCGTTCCCGATGCTGGTCATTCTGCACGCGAGCCT
GGTACTTTAAAGCTTCTTATGGAGGCTACAAACAAATTTGCAGATCTTTAG
Gene >AgabiH97|086040
ATGAAAGTGGTGTTGGGTGATATGATGGGTTATTGGATTATGGCGACGAATTGGAAGGGAGATGGGGGAGTTGTA
TTAAATTTTCTAGATTACAGCGCCTTGTCAGTATCACATGTGCGTAATTCTCATCTTGTCATGATGTTATGATAG
TAGTATTAAAGGAGGGACTAAAGAAGTCTCATGCGGGCGGCACTATTTGTCCTGGGCCGGATGACTCATTTGGCC
GCGTAGCCTTCTCCAGAGTCCACGACAACAGGTTCTCATATTATCCAATAAGTAAGCAAGCAGGTATGTCGTACC
AGCCTATCGAACCCTATGAAACGGGCACCCTCAAGGTCTCCGACATCCACACCCTCTAGTAAGTCGCTTTCTCTT
TCTACCAAATACCAAGCCGATCTAATGATACTATCCCTTAAGTTACGAAATTTCTGGTAATAAGGAAGGGAATCC
AGGTGAGTACATAGCTTGTGTAAGTCGAATCGTGTCTGATGCGTATCTTCAGTGGTCTTCCTCCACGGTTGGTCC
ATCATTCACTCATATTTTCTAATGGATCGCTACACATAAAACAGGTGGCCCTGGAGGAGGGACCAACCCGGGTGA
TCGTACTTTCTTCAACCCTGACAAATACAAGGTTGCTTAATTGGCTGGCAATTTACTATCTCTTCAAGCACTAAC
TCACTTATATAGATTATCCTTTTCGACCAACGAGGCACGGGAAAGTCTACTCCGTAAGTTTTCTTAATGGGAGGT
GATATGAAATCATGTCGCTGACAGGATTTTGTAGAAGAGGATGCTTGGAAGAGAATACTACATGGGATCTTGTGG
ACGATATTGAAAGGCTGAGAGAGAGGTTGGGTATTGAAAAATGGCATGTTTTTGGTGGATCTTGGGTAAAGCGTG
TCTCTCCTGTAGTCATTTTGGACTTTGTTCATTGATTCTTGGGTAGGGATCCACGCTTTCATTGGCGTATGCCCA
GGTGAGTGCCGTTGAAATAGGGTCGTTGAACCACTCACCCTGATGTTCATCCAAGTCTCACCCTAATCGAGTCAA
GTCTCTTGTCATACGGTGAGGAAATATTTTCTCCTGGATAGTTTTCCGGAATTGATTGCCTCGCAGTGGCGTTTG
CACTCTACGCAAGAGGTGGGTCGTCATCAATAACATCGATTGGTACAGTTGATATTCATGTTATCTTAGTGAAAT
GCAGTTTCAGATTCAAAACGGAACTTGCCATCTCTTCCCAGAAGCATGGTGAGTCGGATATGTTACATCTTCCTT
ATCACCTTCTCGAACCCTTCTTTGATCCTTGCACAGGGATGAATTTGTGGCGCCCATTCCAGAGTCCGAGCGAGA
TGATCTTATCTCTGCCTACCACAAGCGACTTAACTCGGATGATGAGGCCACCCGTAAGGCTGCGGCTAAATCATG
GGTGAGATGGGAGTGAGTATCTCTTGTCTTACTACAGGATTTTTTTGTTCTCACTCGAGTGTCTTCCAGGATGTC
GATTTCGAAGCTATATATTGATCCGAATTTGATCGCACTAGCCGATGATGATTATTTCGCCGAGTATATTAGATA
ATTCTCTGCACTCGCACATGTTAACCGGACAATACTGTTTTTTTTTTCAGCGCTTTCGCTCGAATCATAGCCCAC
TATTCTGTAAATGAGGTTCGTACAGCTCCTCAATAATGAATTTCAAGTGTAACGTTTCCGCTACTTAGGGTTTCA
TGAGGGATGGACAATTGCTTGAGAAGGATTCTGTTGATAAGATGTGAACGCCTTCCTTCTCTCCTAACCTATCTC
ATTTTAACGTCTATCAATTATAGCCGCCATATTCCTACTGTTATGATCCAGGGGCGGTACGACGTTGCCTGTCCA
GTAAGATCTTCGTTTTCATTTTGTTCGATAGTCAATATCTAATCTTCACCATAGCCTGCAACCGCGTATGCATTA
AAAAAGGTCTGGCCAAGGGAATTTGACTTTGTTAAAAACTTACTTACTTACTGGTATTTTGTTTACCTAGGTATT
CCCTGAAGCGACCTTGCATATCGTTCCCGATGCTGGTCATTCTGCACGCGAGCCTGGTACTTTAAAGCTTCTTAT
GGAGGTGAAATATCAATATTTCAGTATTTCGAATCCCAAGAATTAATCACATTTGGTGCAGGCTACAAACAAATT
TGCAGATCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail