Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085710
Gene name
Locationscaffold_5:1872545..1874334
Strand+
Gene length (bp)1789
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01556 DnaJ_C DnaJ C terminal domain 4.3E-25 355 510
PF00226 DnaJ DnaJ domain 2.2E-16 3 62

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 354 510 7.0E-14
sp|P25294|SIS1_YEAST Protein SIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIS1 PE=1 SV=1 356 510 1.0E-13
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 354 510 2.0E-12
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 354 510 4.0E-12
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 354 510 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 354 510 7.0E-14
sp|P25294|SIS1_YEAST Protein SIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIS1 PE=1 SV=1 356 510 1.0E-13
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 354 510 2.0E-12
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 354 510 4.0E-12
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 354 510 5.0E-12
sp|Q80Y75|DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus GN=Dnajb13 PE=1 SV=1 357 523 8.0E-12
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 283 510 2.0E-11
sp|P59910|DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens GN=DNAJB13 PE=2 SV=1 357 523 2.0E-10
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 4 55 7.0E-10
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 4 250 1.0E-09
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 354 510 1.0E-09
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 354 510 2.0E-09
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 4 234 4.0E-09
sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 1 62 4.0E-09
sp|Q9LZK5|DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana GN=ERDJ3B PE=1 SV=1 2 62 7.0E-09
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 4 234 7.0E-09
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 4 55 9.0E-09
sp|Q5XGU5|DNJ6B_XENLA DnaJ homolog subfamily B member 6-B OS=Xenopus laevis GN=dnajb6-b PE=2 SV=1 1 62 1.0E-08
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 4 55 1.0E-08
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 4 61 2.0E-08
sp|A7HZ38|DNAJ_PARL1 Chaperone protein DnaJ OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaJ PE=3 SV=1 4 66 2.0E-08
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 4 66 2.0E-08
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 4 62 2.0E-08
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 354 510 2.0E-08
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 4 62 3.0E-08
sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 4 62 3.0E-08
sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 4 62 3.0E-08
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 4 62 4.0E-08
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 4 62 4.0E-08
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 4 66 4.0E-08
sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=1 SV=2 2 62 4.0E-08
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 4 66 4.0E-08
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 4 66 4.0E-08
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 4 66 4.0E-08
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 4 66 4.0E-08
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 4 66 5.0E-08
sp|B8D757|DNAJ_BUCAT Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaJ PE=3 SV=1 4 94 5.0E-08
sp|A8EXP6|DNAJ_RICCK Chaperone protein DnaJ OS=Rickettsia canadensis (strain McKiel) GN=dnaJ PE=3 SV=1 4 63 5.0E-08
sp|O32465|DNAJ_BUCAI Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaJ PE=3 SV=2 4 94 5.0E-08
sp|B8D8V3|DNAJ_BUCA5 Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaJ PE=3 SV=1 4 94 5.0E-08
sp|Q75VW3|DNAJ_HYDTT Chaperone protein DnaJ OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=dnaJ PE=3 SV=1 4 61 5.0E-08
sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 4 61 6.0E-08
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 4 66 6.0E-08
sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 4 63 7.0E-08
sp|Q1RHG9|DNAJ_RICBR Chaperone protein DnaJ OS=Rickettsia bellii (strain RML369-C) GN=dnaJ PE=3 SV=1 4 63 7.0E-08
sp|P25686|DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens GN=DNAJB2 PE=1 SV=3 2 62 8.0E-08
sp|A8GV67|DNAJ_RICB8 Chaperone protein DnaJ OS=Rickettsia bellii (strain OSU 85-389) GN=dnaJ PE=3 SV=1 4 63 9.0E-08
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 4 62 1.0E-07
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 4 66 1.0E-07
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 4 66 1.0E-07
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 4 66 1.0E-07
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 4 66 1.0E-07
sp|Q9QYI8|DNJB7_MOUSE DnaJ homolog subfamily B member 7 OS=Mus musculus GN=Dnajb7 PE=2 SV=2 4 62 1.0E-07
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 4 66 1.0E-07
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 4 66 1.0E-07
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 4 66 1.0E-07
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 4 62 1.0E-07
sp|Q5RBD7|DJC22_PONAB DnaJ homolog subfamily C member 22 OS=Pongo abelii GN=DNAJC22 PE=2 SV=1 3 65 1.0E-07
sp|Q7Z6W7|DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens GN=DNAJB7 PE=2 SV=2 4 62 1.0E-07
sp|B0S1F7|DNAJ_FINM2 Chaperone protein DnaJ OS=Finegoldia magna (strain ATCC 29328) GN=dnaJ PE=3 SV=1 4 61 1.0E-07
sp|B2IBR5|DNAJ_BEII9 Chaperone protein DnaJ OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaJ PE=3 SV=1 4 63 1.0E-07
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|A1BHL1|DNAJ_CHLPD Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1 4 88 1.0E-07
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 4 66 1.0E-07
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 4 66 2.0E-07
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 1 63 2.0E-07
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 4 85 2.0E-07
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 4 55 2.0E-07
sp|O35723|DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus GN=Dnajb3 PE=2 SV=1 4 63 2.0E-07
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 4 63 2.0E-07
sp|Q49Y21|DNAJ_STAS1 Chaperone protein DnaJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaJ PE=3 SV=1 4 61 2.0E-07
sp|Q8N4W6|DJC22_HUMAN DnaJ homolog subfamily C member 22 OS=Homo sapiens GN=DNAJC22 PE=2 SV=1 3 66 2.0E-07
sp|Q74IT7|DNAJ_LACJO Chaperone protein DnaJ OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaJ PE=3 SV=1 4 64 3.0E-07
sp|Q8K9Y9|DNAJ_BUCAP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaJ PE=3 SV=1 4 66 3.0E-07
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 355 510 3.0E-07
sp|Q4UJK6|DNAJ_RICFE Chaperone protein DnaJ OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dnaJ PE=3 SV=1 4 63 3.0E-07
sp|Q044A8|DNAJ_LACGA Chaperone protein DnaJ OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaJ PE=3 SV=1 4 64 3.0E-07
sp|Q8A8C3|DNAJ_BACTN Chaperone protein DnaJ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaJ PE=3 SV=1 341 517 3.0E-07
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 4 70 3.0E-07
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 354 523 4.0E-07
sp|Q75WD2|DNAJ_ACEP3 Chaperone protein DnaJ OS=Acetobacter pasteurianus (strain NBRC 3283 / LMG 1513 / CCTM 1153) GN=dnaJ PE=3 SV=2 1 66 4.0E-07
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 359 510 4.0E-07
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 4 62 4.0E-07
sp|Q9LYW9|DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana GN=P58IPK PE=1 SV=1 4 55 4.0E-07
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 4 61 4.0E-07
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 1 63 4.0E-07
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 1 63 4.0E-07
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 1 63 4.0E-07
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 1 63 4.0E-07
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 4 63 4.0E-07
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 1 63 4.0E-07
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 354 523 5.0E-07
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 354 523 5.0E-07
sp|Q92J37|DNAJ_RICCN Chaperone protein DnaJ OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dnaJ PE=3 SV=1 4 63 5.0E-07
sp|C3PMM6|DNAJ_RICAE Chaperone protein DnaJ OS=Rickettsia africae (strain ESF-5) GN=dnaJ PE=3 SV=1 4 63 5.0E-07
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 4 70 5.0E-07
sp|A7GT07|DNAJ_BACCN Chaperone protein DnaJ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaJ PE=3 SV=1 4 61 5.0E-07
sp|A8F0U0|DNAJ_RICM5 Chaperone protein DnaJ OS=Rickettsia massiliae (strain Mtu5) GN=dnaJ PE=3 SV=1 4 63 6.0E-07
sp|Q9ZDY0|DNAJ_RICPR Chaperone protein DnaJ OS=Rickettsia prowazekii (strain Madrid E) GN=dnaJ PE=3 SV=1 4 63 6.0E-07
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 1 63 6.0E-07
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 4 63 6.0E-07
sp|Q68XI3|DNAJ_RICTY Chaperone protein DnaJ OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dnaJ PE=3 SV=1 4 63 6.0E-07
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 341 517 6.0E-07
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 376 510 7.0E-07
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 1 63 7.0E-07
sp|B1LZ52|DNAJ_METRJ Chaperone protein DnaJ OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaJ PE=3 SV=1 4 63 7.0E-07
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 341 510 7.0E-07
sp|B9KFK6|DNAJ_CAMLR Chaperone protein DnaJ OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaJ PE=3 SV=1 1 61 8.0E-07
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 4 55 8.0E-07
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 4 66 9.0E-07
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 4 55 9.0E-07
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 4 63 9.0E-07
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 4 66 9.0E-07
sp|Q5NPS5|DNAJ_ZYMMO Chaperone protein DnaJ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaJ PE=3 SV=1 377 510 9.0E-07
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 4 61 9.0E-07
sp|B0S1F7|DNAJ_FINM2 Chaperone protein DnaJ OS=Finegoldia magna (strain ATCC 29328) GN=dnaJ PE=3 SV=1 387 510 1.0E-06
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 341 510 1.0E-06
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 4 66 1.0E-06
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 4 73 1.0E-06
sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 1 61 1.0E-06
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 4 66 1.0E-06
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 4 73 1.0E-06
sp|Q5HNW7|DNAJ_STAEQ Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaJ PE=3 SV=1 4 61 1.0E-06
sp|A8GMF8|DNAJ_RICAH Chaperone protein DnaJ OS=Rickettsia akari (strain Hartford) GN=dnaJ PE=3 SV=1 4 63 1.0E-06
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 4 63 1.0E-06
sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 4 61 1.0E-06
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 4 61 1.0E-06
sp|Q56237|DNAJ2_THET8 Chaperone protein DnaJ 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ2 PE=3 SV=2 4 61 1.0E-06
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 4 63 1.0E-06
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 4 63 1.0E-06
sp|Q7NBW0|DNAJ_MYCGA Chaperone protein DnaJ OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaJ PE=3 SV=2 4 61 1.0E-06
sp|B9KPP3|DNAJ_RHOSK Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=dnaJ PE=3 SV=1 4 68 1.0E-06
sp|Q3IYM8|DNAJ_RHOS4 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaJ PE=3 SV=1 4 68 1.0E-06
sp|A3PNM0|DNAJ_RHOS1 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaJ PE=3 SV=1 4 68 1.0E-06
sp|Q057X7|DNAJ_BUCCC Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dnaJ PE=3 SV=1 4 91 1.0E-06
sp|B3EE31|DNAJ_CHLL2 Chaperone protein DnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1 4 61 1.0E-06
sp|A8FMW6|DNAJ_CAMJ8 Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dnaJ PE=3 SV=1 1 61 1.0E-06
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 4 55 1.0E-06
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 4 66 1.0E-06
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 4 61 1.0E-06
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 4 66 1.0E-06
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 4 66 1.0E-06
sp|Q5HTK3|DNAJ_CAMJR Chaperone protein DnaJ OS=Campylobacter jejuni (strain RM1221) GN=dnaJ PE=3 SV=1 1 61 1.0E-06
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 4 63 1.0E-06
sp|A7H2C0|DNAJ_CAMJD Chaperone protein DnaJ OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaJ PE=3 SV=1 1 61 1.0E-06
sp|C4K111|DNAJ_RICPU Chaperone protein DnaJ OS=Rickettsia peacockii (strain Rustic) GN=dnaJ PE=3 SV=1 4 63 1.0E-06
sp|O85213|DNAJ_CAMJE Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaJ PE=3 SV=2 1 61 1.0E-06
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 4 61 2.0E-06
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 4 63 2.0E-06
sp|Q65U54|DNAJ_MANSM Chaperone protein DnaJ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaJ PE=3 SV=2 4 66 2.0E-06
sp|Q6F150|DNAJ_MESFL Chaperone protein DnaJ OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=dnaJ PE=3 SV=1 4 61 2.0E-06
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 4 61 2.0E-06
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 4 66 2.0E-06
sp|B0TYF3|DNAJ_FRAP2 Chaperone protein DnaJ OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaJ PE=3 SV=1 4 61 2.0E-06
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 4 63 2.0E-06
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 1 85 2.0E-06
sp|O67623|DNAJ1_AQUAE Chaperone protein DnaJ 1 OS=Aquifex aeolicus (strain VF5) GN=dnaJ1 PE=3 SV=1 4 61 2.0E-06
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 4 63 2.0E-06
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 4 63 2.0E-06
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 4 61 2.0E-06
sp|A5FZ18|DNAJ_ACICJ Chaperone protein DnaJ OS=Acidiphilium cryptum (strain JF-5) GN=dnaJ PE=3 SV=1 4 63 2.0E-06
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 4 63 2.0E-06
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 4 63 2.0E-06
sp|Q5FSL4|DNAJ_GLUOX Chaperone protein DnaJ OS=Gluconobacter oxydans (strain 621H) GN=dnaJ PE=3 SV=1 1 63 2.0E-06
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 1 63 2.0E-06
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 4 94 2.0E-06
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 1 85 2.0E-06
sp|A1W0P5|DNAJ_CAMJJ Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=dnaJ PE=3 SV=1 1 61 2.0E-06
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 4 55 2.0E-06
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 4 66 2.0E-06
sp|A8GR21|DNAJ_RICRS Chaperone protein DnaJ OS=Rickettsia rickettsii (strain Sheila Smith) GN=dnaJ PE=3 SV=1 4 63 3.0E-06
sp|A1AW21|DNAJ_RUTMC Chaperone protein DnaJ OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaJ PE=3 SV=1 4 79 3.0E-06
sp|Q6MT07|DNAJ_MYCMS Chaperone protein DnaJ OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=dnaJ PE=3 SV=1 4 61 3.0E-06
sp|P71500|DNAJ_MYCCT Chaperone protein DnaJ OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=dnaJ PE=3 SV=2 4 61 3.0E-06
sp|B0BWH0|DNAJ_RICRO Chaperone protein DnaJ OS=Rickettsia rickettsii (strain Iowa) GN=dnaJ PE=3 SV=1 4 63 3.0E-06
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 4 66 3.0E-06
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 4 63 3.0E-06
sp|A7FME2|DNAJ_YERP3 Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaJ PE=3 SV=1 4 66 3.0E-06
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 4 63 3.0E-06
sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 4 61 3.0E-06
sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 4 61 3.0E-06
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 4 63 3.0E-06
sp|P26508|NOLC_RHIFR Protein NolC OS=Rhizobium fredii GN=nolC PE=3 SV=1 4 63 3.0E-06
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 4 66 3.0E-06
sp|Q1G9R3|DNAJ_LACDA Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaJ PE=3 SV=1 4 58 3.0E-06
sp|Q049W7|DNAJ_LACDB Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaJ PE=3 SV=1 4 58 3.0E-06
sp|C5D4U0|DNAJ_GEOSW Chaperone protein DnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1 4 61 3.0E-06
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 4 63 3.0E-06
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 4 56 3.0E-06
sp|B3QPW8|DNAJ_CHLP8 Chaperone protein DnaJ OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|Q8FXX1|DNAJ_BRUSU Chaperone protein DnaJ OS=Brucella suis biovar 1 (strain 1330) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|B0CJX5|DNAJ_BRUSI Chaperone protein DnaJ OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|Q8YE77|DNAJ_BRUME Chaperone protein DnaJ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|C0RG11|DNAJ_BRUMB Chaperone protein DnaJ OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|A9M9V9|DNAJ_BRUC2 Chaperone protein DnaJ OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|Q57AD6|DNAJ_BRUAB Chaperone protein DnaJ OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|Q2YQV1|DNAJ_BRUA2 Chaperone protein DnaJ OS=Brucella abortus (strain 2308) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|B2S9C2|DNAJ_BRUA1 Chaperone protein DnaJ OS=Brucella abortus (strain S19) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|Q9KWS6|DNAJ_GEOTM Chaperone protein DnaJ OS=Geobacillus thermoglucosidasius GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|P73097|DNAJ2_SYNY3 Chaperone protein DnaJ 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ2 PE=3 SV=1 4 61 4.0E-06
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 4 66 4.0E-06
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 4 55 4.0E-06
sp|B0UWR3|DNAJ_HISS2 Chaperone protein DnaJ OS=Histophilus somni (strain 2336) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|P35514|DNAJ_LACLA Chaperone protein DnaJ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dnaJ PE=3 SV=2 4 66 4.0E-06
sp|Q0I3V1|DNAJ_HAES1 Chaperone protein DnaJ OS=Haemophilus somnus (strain 129Pt) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 4 66 4.0E-06
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 4 66 4.0E-06
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|P63969|DNAJ_NEIMB Chaperone protein DnaJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|P63968|DNAJ_NEIMA Chaperone protein DnaJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|B8DE39|DNAJ_LISMH Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|Q92BN9|DNAJ_LISIN Chaperone protein DnaJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 4 63 4.0E-06
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 1 61 4.0E-06
sp|P0DJM1|DNAJ_LISMO Chaperone protein DnaJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|G2K045|DNAJ_LISM4 Chaperone protein DnaJ OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaJ PE=3 SV=1 4 61 4.0E-06
sp|Q03QU2|DNAJ_LACBA Chaperone protein DnaJ OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaJ PE=3 SV=1 4 69 4.0E-06
sp|Q05980|DNAJ_BRUO2 Chaperone protein DnaJ OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaJ PE=2 SV=2 4 63 4.0E-06
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 2 66 5.0E-06
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 2 66 5.0E-06
sp|Q73IV4|DNAJ_WOLPM Chaperone protein DnaJ OS=Wolbachia pipientis wMel GN=dnaJ PE=3 SV=1 4 61 5.0E-06
sp|A4WW88|DNAJ_RHOS5 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaJ PE=3 SV=1 4 68 5.0E-06
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 4 66 5.0E-06
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 4 63 5.0E-06
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 4 63 5.0E-06
sp|A4IR30|DNAJ_GEOTN Chaperone protein DnaJ OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaJ PE=3 SV=1 4 61 5.0E-06
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 4 63 5.0E-06
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 4 66 5.0E-06
sp|Q3IC07|DNAJ_PSEHT Chaperone protein DnaJ OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaJ PE=3 SV=1 4 61 5.0E-06
sp|A7Z6W0|DNAJ_BACMF Chaperone protein DnaJ OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaJ PE=3 SV=1 4 61 5.0E-06
sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 4 61 5.0E-06
sp|B5ENA2|DNAJ_ACIF5 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaJ PE=3 SV=1 4 63 5.0E-06
sp|B7J7X8|DNAJ_ACIF2 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaJ PE=3 SV=1 4 63 5.0E-06
sp|Q45552|DNAJ_GEOSE Chaperone protein DnaJ OS=Geobacillus stearothermophilus GN=dnaJ PE=3 SV=1 4 61 5.0E-06
sp|Q04Y48|DNAJ_LEPBL Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1 2 66 6.0E-06
sp|Q04VC7|DNAJ_LEPBJ Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1 2 66 6.0E-06
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|P45555|DNAJ_STAAU Chaperone protein DnaJ OS=Staphylococcus aureus GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 4 66 6.0E-06
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 4 66 6.0E-06
sp|A9VHU0|DNAJ_BACWK Chaperone protein DnaJ OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|A5CX57|DNAJ_VESOH Chaperone protein DnaJ OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dnaJ PE=3 SV=1 4 66 6.0E-06
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 4 61 6.0E-06
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q93Q66|DNAJ_LACLC Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris GN=dnaJ PE=3 SV=1 4 66 6.0E-06
sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q6HDK8|DNAJ_BACHK Chaperone protein DnaJ OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|B9IY80|DNAJ_BACCQ Chaperone protein DnaJ OS=Bacillus cereus (strain Q1) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|B7HPL2|DNAJ_BACC7 Chaperone protein DnaJ OS=Bacillus cereus (strain AH187) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q730M2|DNAJ_BACC1 Chaperone protein DnaJ OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q81LS3|DNAJ_BACAN Chaperone protein DnaJ OS=Bacillus anthracis GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|C3L5R6|DNAJ_BACAC Chaperone protein DnaJ OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|C3P8L9|DNAJ_BACAA Chaperone protein DnaJ OS=Bacillus anthracis (strain A0248) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 4 61 6.0E-06
sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q5HFI1|DNAJ_STAAC Chaperone protein DnaJ OS=Staphylococcus aureus (strain COL) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|A5ITA7|DNAJ_STAA9 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH9) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q2FXZ3|DNAJ_STAA8 Chaperone protein DnaJ OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q2FGE4|DNAJ_STAA3 Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|A6U251|DNAJ_STAA2 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH1) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|A7X2Y0|DNAJ_STAA1 Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q634M8|DNAJ_BACCZ Chaperone protein DnaJ OS=Bacillus cereus (strain ZK / E33L) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|C1ESK7|DNAJ_BACC3 Chaperone protein DnaJ OS=Bacillus cereus (strain 03BB102) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|B7JN38|DNAJ_BACC0 Chaperone protein DnaJ OS=Bacillus cereus (strain AH820) GN=dnaJ PE=3 SV=1 4 61 6.0E-06
sp|Q8A8C3|DNAJ_BACTN Chaperone protein DnaJ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaJ PE=3 SV=1 4 61 7.0E-06
sp|A9HEA1|DNAJ_GLUDA Chaperone protein DnaJ OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaJ PE=3 SV=1 1 63 7.0E-06
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 4 61 7.0E-06
sp|B5YAR4|DNAJ_DICT6 Chaperone protein DnaJ OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaJ PE=3 SV=1 4 61 7.0E-06
sp|A2RP20|DNAJ_LACLM Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dnaJ PE=3 SV=1 4 66 7.0E-06
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 4 55 7.0E-06
sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 4 61 7.0E-06
sp|Q02VR5|DNAJ_LACLS Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dnaJ PE=3 SV=1 4 66 7.0E-06
sp|Q8DWH2|DNAJ_STRMU Chaperone protein DnaJ OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaJ PE=3 SV=1 4 66 7.0E-06
sp|Q9ZJQ2|DNAJ_HELPJ Chaperone protein DnaJ OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaJ PE=3 SV=1 1 61 7.0E-06
sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 367 510 8.0E-06
sp|B1JL03|DNAJ_YERPY Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|Q66ES9|DNAJ_YERPS Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|A4TQF8|DNAJ_YERPP Chaperone protein DnaJ OS=Yersinia pestis (strain Pestoides F) GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|Q1CMV6|DNAJ_YERPN Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|A9R014|DNAJ_YERPG Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|Q8ZIM6|DNAJ_YERPE Chaperone protein DnaJ OS=Yersinia pestis GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|B2K3M1|DNAJ_YERPB Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|Q1C0J8|DNAJ_YERPA Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|Q4FVQ7|DNAJ_PSYA2 Chaperone protein DnaJ OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaJ PE=3 SV=1 4 63 8.0E-06
sp|O25890|DNAJ_HELPY Chaperone protein DnaJ OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaJ PE=3 SV=1 1 61 8.0E-06
sp|P42381|DNAJ_COXBU Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaJ PE=3 SV=2 4 61 8.0E-06
sp|A9N8H1|DNAJ_COXBR Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaJ PE=3 SV=1 4 61 8.0E-06
sp|Q7VG06|DNAJ_HELHP Chaperone protein DnaJ OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dnaJ PE=3 SV=1 4 66 8.0E-06
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 4 66 9.0E-06
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 4 66 9.0E-06
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 4 66 9.0E-06
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 4 66 9.0E-06
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 4 66 9.0E-06
sp|A6VNB0|DNAJ_ACTSZ Chaperone protein DnaJ OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaJ PE=3 SV=1 4 66 9.0E-06
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 4 66 9.0E-06
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 4 66 9.0E-06
sp|Q03FR6|DNAJ_PEDPA Chaperone protein DnaJ OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaJ PE=3 SV=1 4 61 9.0E-06
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 4 55 9.0E-06
sp|A4IX29|DNAJ_FRATW Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaJ PE=3 SV=1 4 61 9.0E-06
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 4 63 9.0E-06
sp|Q6KHF9|DNAJ_MYCMO Chaperone protein DnaJ OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaJ PE=3 SV=1 4 66 9.0E-06
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein DnaJ OS=Geobacillus kaustophilus (strain HTA426) GN=dnaJ PE=3 SV=1 4 61 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085710
MSSYDVLQVSCTATEEEIRMAYKTMAKQWHPDRKLDDQETATRKFKEINSAYRAILHERRRDAKRQSSSMPSPSK
PSSSRETHNSASSSKSLPDNSRQSSNPKTIQSDNKTATTIIHSNKGYDENVEEPHKRHRSGVRKEEKDSLAKAAA
TPSSMSSYTSSPSSSSSIPLPSLSSFSSQASSSGSSTSSRSSSSSRTSSRKSGADFDTFSPTSSRTSVTTGSTDD
LREHDVGGSKEQPPRVPGATTLLFTSFASSEVSTHEDDIPEITLSDVLGVELKHCDADIILPATSISDEGSSSST
TPSEVERRQKLSKSSHTKDSSKAIKEDGERSDRTLIPEFDCPLARSVGLTKQWTYTIQLTLQQLFRGKKMRFKIV
RCKLDGKRKSVTLDVTIPPGTLHGTQVIFKAAGHELKNGTRQDIVFIIEEAKHERFVRMKEDLALDVRLPWVESL
KKEVGTVHVQSLDGKEYKFEVDFKTDANVTGTTVIPDAGMPIPKTKKRGDLIVRWEIYMPPAPSRWETFKQALHL
*
Coding >AgabiH97|085710
ATGAGTTCTTATGATGTTTTGCAAGTGTCGTGTACGGCGACGGAAGAGGAGATTAGGATGGCTTATAAGACAATG
GCGAAGCAGTGGCATCCGGATAGGAAACTAGATGACCAAGAAACGGCGACGAGGAAATTCAAAGAGATTAACTCT
GCTTATCGAGCAATCCTTCACGAACGTCGCCGCGATGCAAAGAGGCAATCATCGTCCATGCCATCTCCTTCGAAG
CCTTCTTCCTCCCGTGAAACTCATAACTCAGCATCGTCTTCTAAATCCTTACCTGACAACAGTCGTCAATCTTCT
AATCCCAAAACAATACAATCGGACAATAAGACCGCTACTACAATAATTCATTCAAATAAAGGCTATGATGAAAAC
GTGGAGGAACCTCATAAACGCCACCGCAGTGGTGTACGTAAAGAAGAAAAAGATTCGCTAGCAAAAGCGGCTGCA
ACACCGTCGTCTATGTCTTCATATACGTCCTCTCCGAGTTCATCTTCCTCGATCCCCCTTCCGTCTCTATCGTCT
TTTTCTTCTCAGGCTTCCTCCTCTGGTTCTTCTACTTCTTCGAGATCATCCAGCAGTTCCAGGACATCCTCTCGT
AAAAGCGGCGCGGATTTTGACACGTTTAGTCCTACTTCAAGTCGCACTTCGGTTACAACAGGGTCTACAGATGAC
TTACGCGAACACGATGTCGGAGGTAGCAAAGAACAACCCCCTCGTGTTCCGGGTGCTACCACGCTTTTGTTTACC
TCTTTCGCTTCTTCTGAAGTCTCTACGCATGAAGACGACATCCCTGAAATCACGCTTTCTGACGTATTAGGTGTC
GAACTCAAACACTGCGATGCCGACATTATATTGCCTGCAACATCCATTTCGGATGAGGGATCTTCATCCTCAACG
ACACCTTCCGAAGTCGAGAGGAGGCAAAAATTATCGAAATCTAGTCATACCAAGGATTCTTCAAAGGCGATCAAG
GAAGATGGTGAACGCAGTGACCGAACCTTGATACCGGAGTTCGACTGCCCTCTAGCACGATCTGTTGGTCTTACG
AAACAGTGGACGTATACAATTCAATTAACCCTTCAACAATTGTTTCGCGGCAAGAAAATGCGTTTCAAAATCGTT
CGGTGCAAACTTGACGGCAAACGTAAATCTGTTACATTGGACGTCACTATTCCTCCTGGAACACTTCATGGAACA
CAGGTCATATTCAAAGCAGCAGGTCATGAATTAAAAAACGGGACGAGGCAGGACATTGTTTTCATTATTGAGGAG
GCGAAACATGAGAGATTTGTGAGGATGAAGGAGGATTTGGCTTTGGATGTCCGATTGCCTTGGGTTGAGAGTTTG
AAGAAGGAGGTTGGTACGGTTCATGTTCAAAGTCTTGACGGAAAGGAATACAAGTTTGAGGTGGATTTCAAAACG
GACGCGAATGTTACGGGGACGACGGTTATTCCGGATGCTGGAATGCCTATTCCTAAAACGAAGAAAAGGGGAGAT
TTGATTGTCAGATGGGAAATTTACATGCCTCCTGCGCCATCGCGATGGGAGACGTTTAAGCAGGCATTACATTTG
TGA
Transcript >AgabiH97|085710
ATGAGTTCTTATGATGTTTTGCAAGTGTCGTGTACGGCGACGGAAGAGGAGATTAGGATGGCTTATAAGACAATG
GCGAAGCAGTGGCATCCGGATAGGAAACTAGATGACCAAGAAACGGCGACGAGGAAATTCAAAGAGATTAACTCT
GCTTATCGAGCAATCCTTCACGAACGTCGCCGCGATGCAAAGAGGCAATCATCGTCCATGCCATCTCCTTCGAAG
CCTTCTTCCTCCCGTGAAACTCATAACTCAGCATCGTCTTCTAAATCCTTACCTGACAACAGTCGTCAATCTTCT
AATCCCAAAACAATACAATCGGACAATAAGACCGCTACTACAATAATTCATTCAAATAAAGGCTATGATGAAAAC
GTGGAGGAACCTCATAAACGCCACCGCAGTGGTGTACGTAAAGAAGAAAAAGATTCGCTAGCAAAAGCGGCTGCA
ACACCGTCGTCTATGTCTTCATATACGTCCTCTCCGAGTTCATCTTCCTCGATCCCCCTTCCGTCTCTATCGTCT
TTTTCTTCTCAGGCTTCCTCCTCTGGTTCTTCTACTTCTTCGAGATCATCCAGCAGTTCCAGGACATCCTCTCGT
AAAAGCGGCGCGGATTTTGACACGTTTAGTCCTACTTCAAGTCGCACTTCGGTTACAACAGGGTCTACAGATGAC
TTACGCGAACACGATGTCGGAGGTAGCAAAGAACAACCCCCTCGTGTTCCGGGTGCTACCACGCTTTTGTTTACC
TCTTTCGCTTCTTCTGAAGTCTCTACGCATGAAGACGACATCCCTGAAATCACGCTTTCTGACGTATTAGGTGTC
GAACTCAAACACTGCGATGCCGACATTATATTGCCTGCAACATCCATTTCGGATGAGGGATCTTCATCCTCAACG
ACACCTTCCGAAGTCGAGAGGAGGCAAAAATTATCGAAATCTAGTCATACCAAGGATTCTTCAAAGGCGATCAAG
GAAGATGGTGAACGCAGTGACCGAACCTTGATACCGGAGTTCGACTGCCCTCTAGCACGATCTGTTGGTCTTACG
AAACAGTGGACGTATACAATTCAATTAACCCTTCAACAATTGTTTCGCGGCAAGAAAATGCGTTTCAAAATCGTT
CGGTGCAAACTTGACGGCAAACGTAAATCTGTTACATTGGACGTCACTATTCCTCCTGGAACACTTCATGGAACA
CAGGTCATATTCAAAGCAGCAGGTCATGAATTAAAAAACGGGACGAGGCAGGACATTGTTTTCATTATTGAGGAG
GCGAAACATGAGAGATTTGTGAGGATGAAGGAGGATTTGGCTTTGGATGTCCGATTGCCTTGGGTTGAGAGTTTG
AAGAAGGAGGTTGGTACGGTTCATGTTCAAAGTCTTGACGGAAAGGAATACAAGTTTGAGGTGGATTTCAAAACG
GACGCGAATGTTACGGGGACGACGGTTATTCCGGATGCTGGAATGCCTATTCCTAAAACGAAGAAAAGGGGAGAT
TTGATTGTCAGATGGGAAATTTACATGCCTCCTGCGCCATCGCGATGGGAGACGTTTAAGCAGGCATTACATTTG
TGA
Gene >AgabiH97|085710
ATGAGTTCTTATGATGTTTTGCAAGTGTCGTGTACGGCGACGGAAGAGGAGATTAGGATGGCTTATAAGACAATG
GTTCGTGGGTTCCTTTGTTTTCTAATTTGGAAGCATGGAACAAATTCTTATTTTGGATGTATTGTTTTTTTTTGG
TCGTTGTACTGCATGTAGGCGAAGCAGTGGCATCCGGATAGGAAACTAGATGACCAAGAAACGGCGACGAGGAAA
TTCAAAGAGGTAAGTTCCTGTTCCTTTTTGTTTGATGATACGCTTTGATTGGGTTGACTCAATCGAATTATAGAT
TAACTCTGCTTATCGAGCAATCCTTCACGAACGTCGCCGCGATGCAAAGAGGCAATCATCGTCCATGCCATCTCC
TTCGAAGCCTTCTTCCTCCCGTGAAACTCATAACTCAGCATCGTCTTCTAAATCCTTACCTGACAACAGTCGTCA
ATCTTCTAATCCCAAAACAATACAATCGGACAATAAGACCGCTACTACAATAATTCATTCAAATAAAGGCTATGA
TGAAAACGTGGAGGAACCTCATAAACGCCACCGCAGTGGTGTACGTAAAGAAGAAAAAGATTCGCTAGCAAAAGC
GGCTGCAACACCGTCGTCTATGTCTTCATATACGTCCTCTCCGAGTTCATCTTCCTCGATCCCCCTTCCGTCTCT
ATCGTCTTTTTCTTCTCAGGCTTCCTCCTCTGGTTCTTCTACTTCTTCGAGATCATCCAGCAGTTCCAGGACATC
CTCTCGTAAAAGCGGCGCGGATTTTGACACGTTTAGTCCTACTTCAAGTCGCACTTCGGTTACAACAGGGTCTAC
AGATGACTTACGCGAACACGATGTCGGAGGTAGCAAAGAACAACCCCCTCGTGTTCCGGGTGCTACCACGCTTTT
GTTTACCTCTTTCGCTTCTTCTGAAGTCTCTACGCATGAAGACGACATCCCTGAAATCACGCTTTCTGACGTATT
AGGTGTCGAACTCAAACACTGCGATGCCGACATTATATTGCCTGCAACATCCATTTCGGATGAGGGATCTTCATC
CTCAACGACACCTTCCGAAGTCGAGAGGAGGCAAAAATTATCGAAATCTAGTCATACCAAGGATTCTTCAAAGGC
GATCAAGGAAGATGGTGAACGCAGTGACCGAACCTTGATACCGGAGTTCGACTGCCCTCTAGCACGATCTGTTGG
TCTTACGAAACAGTGGACGTATACAATTCAATTAACCCTTCAACAATTGTTTCGCGGCAAGAAAATGCGTTTCAA
AATCGTTCGGTGCAAACTTGACGGCAAACGTAAATCTGTTACATTGGACGTCACTATTCCTCCTGGAACACTTCA
TGGAACACAGGTCATATTCAAAGCAGCAGGTCATGAATTAAAAAACGGGACGAGGCAGGACATTGTTTTCATTAT
TGAGGAGGCGAAACATGAGAGATTTGTGAGGATGAAGGAGGATTTGGCTTTGGATGTCCGATTGCCTTGGGTTGA
GAGTTTGAAGAAGGAGGTTGGTACGGTTCATGTTCAAAGTCTTGACGGAAAGGAATACAAGTTTGAGGTGGATTT
CAAAACGGACGCGAATGTTACGGGGACGACGGTTATTCCGGATGCTGGAATGCCTATTCCTAAAACGAAGAAAAG
GGGAGATTTGATTGTCAGGTGAGTTAATTGTCTTAGATCTTATTCAGATCTAAATGATGATTGGAAATATAGATG
GGAAATTTACATGCCTCCTGCGCCATCGCGATGGGAGACGTTTAAGCAGGCATTACATTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail