Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085650
Gene name
Locationscaffold_5:1858873..1859187
Strand-
Gene length (bp)314
Transcript length (bp)216
Coding sequence length (bp)216
Protein length (aa) 72

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05493 ATP_synt_H ATP synthase subunit H 6.0E-19 8 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q69Z14|VA0E_SCHPO V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma9 PE=3 SV=2 24 69 1.0E-08
sp|Q3E7B6|VA0E_YEAST V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 3 67 4.0E-08
sp|Q20591|VA0E_CAEEL V-type proton ATPase subunit e OS=Caenorhabditis elegans GN=vha-17 PE=3 SV=2 8 70 3.0E-07
sp|Q5K8S8|VA0E_CRYNJ V-type proton ATPase subunit e OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA9 PE=3 SV=2 15 67 1.0E-06
sp|Q9BDP4|VA0E1_CANLF V-type proton ATPase subunit e 1 OS=Canis lupus familiaris GN=ATP6V0E1 PE=3 SV=3 7 71 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q69Z14|VA0E_SCHPO V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma9 PE=3 SV=2 24 69 1.0E-08
sp|Q3E7B6|VA0E_YEAST V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 3 67 4.0E-08
sp|Q20591|VA0E_CAEEL V-type proton ATPase subunit e OS=Caenorhabditis elegans GN=vha-17 PE=3 SV=2 8 70 3.0E-07
sp|Q5K8S8|VA0E_CRYNJ V-type proton ATPase subunit e OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA9 PE=3 SV=2 15 67 1.0E-06
sp|Q9BDP4|VA0E1_CANLF V-type proton ATPase subunit e 1 OS=Canis lupus familiaris GN=ATP6V0E1 PE=3 SV=3 7 71 1.0E-06
sp|Q75EU0|VA0E_ASHGO V-type proton ATPase subunit e OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA9 PE=3 SV=1 5 67 3.0E-06
sp|Q8NHE4|VA0E2_HUMAN V-type proton ATPase subunit e 2 OS=Homo sapiens GN=ATP6V0E2 PE=2 SV=1 24 71 5.0E-06
sp|Q2KIB5|VA0E2_BOVIN V-type proton ATPase subunit e 2 OS=Bos taurus GN=ATP6V0E2 PE=3 SV=1 24 71 5.0E-06
sp|Q5EB76|VA0E2_RAT V-type proton ATPase subunit e 2 OS=Rattus norvegicus GN=Atp6v0e2 PE=3 SV=1 24 71 5.0E-06
sp|Q91XE7|VA0E2_MOUSE V-type proton ATPase subunit e 2 OS=Mus musculus GN=Atp6v0e2 PE=3 SV=1 24 71 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0033179 proton-transporting V-type ATPase, V0 domain Yes
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:1902600 proton transmembrane transport Yes
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0006810 transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0022853 active ion transmembrane transporter activity No
GO:0098796 membrane protein complex No
GO:0015399 primary active transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0034220 ion transmembrane transport No
GO:0008150 biological_process No
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:0022804 active transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0140657 ATP-dependent activity No
GO:0051234 establishment of localization No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0032991 protein-containing complex No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0051179 localization No
GO:0015078 proton transmembrane transporter activity No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0006812 cation transport No
GO:0003674 molecular_function No
GO:0098655 cation transmembrane transport No
GO:0022857 transmembrane transporter activity No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 33 55 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 660.75 339.34 982.16
Initials Initials knots 549.48 274.42 824.53
Pileal_Stipeal_center Stage I stipe center 883.62 467.13 1300.11
Pileal_Stipeal_shell Stage I stipe shell 787.85 410.24 1165.46
DIF_stipe_center Stage II stipe center 1030.35 564.45 1496.25
DIF_stipe_shell Stage II stipe shell 970.50 525.31 1415.69
DIF_stipe_skin Stage II stipe skin 855.92 449.08 1262.76
DIF_cap_skin Stage II cap skin 981.00 529.36 1432.64
DIF_cap_tissue Stage II cap tissue 953.67 515.02 1392.31
DIF_gill_tissue Stage II gill tissue 1110.91 613.27 1608.55
YFB_stipe_center Young fruiting body stipe center 1334.71 748.31 1921.11
YFB_stipe_shell Young fruiting body stipe shell 1283.39 717.16 1849.61
YFB_stipe_skin Young fruiting body stipe skin 1129.64 621.35 1637.94
YFB_cap_skin Young fruiting body cap skin 1125.37 618.44 1632.29
YFB_cap_tissue Young fruiting body cap tissue 1123.98 617.92 1630.05
YFB_gill_tissue Young fruiting body gill tissue 927.67 498.58 1356.76
YFB_veil Young fruiting body veil 1007.65 540.64 1474.67

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.119007 no
Casing YFB_stipe_center 0.020790 yes
Casing YFB_stipe_shell 0.030372 yes
Casing YFB_stipe_skin 0.099106 no
Casing YFB_cap_skin 0.102350 no
Casing YFB_cap_tissue 0.101542 no
Casing YFB_gill_tissue 0.386972 no
Casing YFB_veil 0.236585 no
Casing Initials 0.719903 no
Casing Pileal_Stipeal_center 0.493909 no
Casing Pileal_Stipeal_shell 0.725524 no
Casing DIF_stipe_center 0.199255 no
Casing DIF_stipe_shell 0.302886 no
Casing DIF_stipe_skin 0.557601 no
Casing DIF_cap_skin 0.280365 no
Casing DIF_cap_tissue 0.335232 no
DIF_gill_tissue YFB_stipe_center 0.672936 no
DIF_gill_tissue YFB_stipe_shell 0.758239 no
DIF_gill_tissue YFB_stipe_skin 0.978374 no
DIF_gill_tissue YFB_cap_skin 0.983081 no
DIF_gill_tissue YFB_cap_tissue 0.983895 no
DIF_gill_tissue YFB_gill_tissue 0.692626 no
DIF_gill_tissue YFB_veil 0.857077 no
YFB_stipe_center YFB_stipe_shell 0.947036 no
YFB_stipe_center YFB_stipe_skin 0.706409 no
YFB_stipe_center YFB_cap_skin 0.703879 no
YFB_stipe_center YFB_cap_tissue 0.699796 no
YFB_stipe_center YFB_gill_tissue 0.289190 no
YFB_stipe_center YFB_veil 0.461469 no
YFB_stipe_shell YFB_stipe_skin 0.788728 no
YFB_stipe_shell YFB_cap_skin 0.783955 no
YFB_stipe_shell YFB_cap_tissue 0.782131 no
YFB_stipe_shell YFB_gill_tissue 0.367408 no
YFB_stipe_shell YFB_veil 0.542795 no
YFB_stipe_skin YFB_cap_skin 0.994313 no
YFB_stipe_skin YFB_cap_tissue 0.991957 no
YFB_stipe_skin YFB_gill_tissue 0.653430 no
YFB_stipe_skin YFB_veil 0.828081 no
YFB_cap_skin YFB_cap_tissue 0.997863 no
YFB_cap_skin YFB_gill_tissue 0.665064 no
YFB_cap_skin YFB_veil 0.834887 no
YFB_cap_tissue YFB_gill_tissue 0.670370 no
YFB_cap_tissue YFB_veil 0.838558 no
YFB_gill_tissue YFB_veil 0.882336 no
Initials DIF_gill_tissue 0.029648 yes
Initials YFB_stipe_center 0.004160 yes
Initials YFB_stipe_shell 0.006387 yes
Initials YFB_stipe_skin 0.023676 yes
Initials YFB_cap_skin 0.025711 yes
Initials YFB_cap_tissue 0.025458 yes
Initials YFB_gill_tissue 0.122622 no
Initials YFB_veil 0.066022 no
Initials Pileal_Stipeal_center 0.190009 no
Initials Pileal_Stipeal_shell 0.356290 no
Initials DIF_stipe_center 0.053565 no
Initials DIF_stipe_shell 0.087755 no
Initials DIF_stipe_skin 0.229251 no
Initials DIF_cap_skin 0.081756 no
Initials DIF_cap_tissue 0.102350 no
Pileal_Stipeal_center DIF_gill_tissue 0.597035 no
Pileal_Stipeal_center YFB_stipe_center 0.234746 no
Pileal_Stipeal_center YFB_stipe_shell 0.290957 no
Pileal_Stipeal_center YFB_stipe_skin 0.559368 no
Pileal_Stipeal_center YFB_cap_skin 0.570884 no
Pileal_Stipeal_center YFB_cap_tissue 0.569705 no
Pileal_Stipeal_center YFB_gill_tissue 0.937412 no
Pileal_Stipeal_center YFB_veil 0.806937 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.839701 no
Pileal_Stipeal_center DIF_stipe_center 0.756416 no
Pileal_Stipeal_center DIF_stipe_shell 0.872221 no
Pileal_Stipeal_center DIF_stipe_skin 0.962323 no
Pileal_Stipeal_center DIF_cap_skin 0.853107 no
Pileal_Stipeal_center DIF_cap_tissue 0.899247 no
Pileal_Stipeal_shell DIF_gill_tissue 0.345911 no
Pileal_Stipeal_shell YFB_stipe_center 0.095644 no
Pileal_Stipeal_shell YFB_stipe_shell 0.120521 no
Pileal_Stipeal_shell YFB_stipe_skin 0.312218 no
Pileal_Stipeal_shell YFB_cap_skin 0.322969 no
Pileal_Stipeal_shell YFB_cap_tissue 0.321985 no
Pileal_Stipeal_shell YFB_gill_tissue 0.739930 no
Pileal_Stipeal_shell YFB_veil 0.560412 no
Pileal_Stipeal_shell DIF_stipe_center 0.501761 no
Pileal_Stipeal_shell DIF_stipe_shell 0.645992 no
Pileal_Stipeal_shell DIF_stipe_skin 0.890897 no
Pileal_Stipeal_shell DIF_cap_skin 0.621820 no
Pileal_Stipeal_shell DIF_cap_tissue 0.681587 no
DIF_stipe_center DIF_gill_tissue 0.892903 no
DIF_stipe_center YFB_stipe_center 0.494559 no
DIF_stipe_center YFB_stipe_shell 0.581973 no
DIF_stipe_center YFB_stipe_skin 0.859476 no
DIF_stipe_center YFB_cap_skin 0.868718 no
DIF_stipe_center YFB_cap_tissue 0.871947 no
DIF_stipe_center YFB_gill_tissue 0.841754 no
DIF_stipe_center YFB_veil 0.970661 no
DIF_stipe_center DIF_stipe_shell 0.918223 no
DIF_stipe_center DIF_stipe_skin 0.682261 no
DIF_stipe_center DIF_cap_skin 0.933861 no
DIF_stipe_center DIF_cap_tissue 0.891272 no
DIF_stipe_shell DIF_gill_tissue 0.788263 no
DIF_stipe_shell YFB_stipe_center 0.385707 no
DIF_stipe_shell YFB_stipe_shell 0.469431 no
DIF_stipe_shell YFB_stipe_skin 0.750523 no
DIF_stipe_shell YFB_cap_skin 0.761705 no
DIF_stipe_shell YFB_cap_tissue 0.764628 no
DIF_stipe_shell YFB_gill_tissue 0.942026 no
DIF_stipe_shell YFB_veil 0.953056 no
DIF_stipe_shell DIF_stipe_skin 0.814582 no
DIF_stipe_shell DIF_cap_skin 0.985183 no
DIF_stipe_shell DIF_cap_tissue 0.978193 no
DIF_stipe_skin DIF_gill_tissue 0.520132 no
DIF_stipe_skin YFB_stipe_center 0.180832 no
DIF_stipe_skin YFB_stipe_shell 0.226718 no
DIF_stipe_skin YFB_stipe_skin 0.480469 no
DIF_stipe_skin YFB_cap_skin 0.492440 no
DIF_stipe_skin YFB_cap_tissue 0.489647 no
DIF_stipe_skin YFB_gill_tissue 0.889827 no
DIF_stipe_skin YFB_veil 0.740353 no
DIF_stipe_skin DIF_cap_skin 0.791443 no
DIF_stipe_skin DIF_cap_tissue 0.843891 no
DIF_cap_skin DIF_gill_tissue 0.811661 no
DIF_cap_skin YFB_stipe_center 0.405740 no
DIF_cap_skin YFB_stipe_shell 0.488298 no
DIF_cap_skin YFB_stipe_skin 0.773657 no
DIF_cap_skin YFB_cap_skin 0.784191 no
DIF_cap_skin YFB_cap_tissue 0.787070 no
DIF_cap_skin YFB_gill_tissue 0.926131 no
DIF_cap_skin YFB_veil 0.966338 no
DIF_cap_skin DIF_cap_tissue 0.964201 no
DIF_cap_tissue DIF_gill_tissue 0.752391 no
DIF_cap_tissue YFB_stipe_center 0.343444 no
DIF_cap_tissue YFB_stipe_shell 0.422885 no
DIF_cap_tissue YFB_stipe_skin 0.713166 no
DIF_cap_tissue YFB_cap_skin 0.726149 no
DIF_cap_tissue YFB_cap_tissue 0.728004 no
DIF_cap_tissue YFB_gill_tissue 0.965027 no
DIF_cap_tissue YFB_veil 0.927152 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085650
MPPPLFPILAVLVVVAALVACTAFLVPKGPNQVTIRTALMLTLTAAYLMWMITYLAQLHPLIQPVHTIKTE*
Coding >AgabiH97|085650
ATGCCGCCCCCACTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC
GTCCCCAAGGGCCCCAACCAGGTCACCATCCGAACCGCGCTCATGCTCACTTTAACGGCTGCATATTTGATGTGG
ATGATCACCTATTTGGCACAGCTGCATCCCTTGATTCAACCCGTTCATACAATAAAAACGGAGTGA
Transcript >AgabiH97|085650
ATGCCGCCCCCACTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC
GTCCCCAAGGGCCCCAACCAGGTCACCATCCGAACCGCGCTCATGCTCACTTTAACGGCTGCATATTTGATGTGG
ATGATCACCTATTTGGCACAGCTGCATCCCTTGATTCAACCCGTTCATACAATAAAAACGGAGTGA
Gene >AgabiH97|085650
ATGCCGCCCCCACTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC
GTCCCCAAGGGCCCCAACCAGGTGTACGTGTTCTGCTCGTCTTCCCTTGCACTTTTCTCACCCGAGCCCTCTAGC
ACCATCCGAACCGCGCTCATGCTCACTTTAACGGCTGCATATTTGATGTGGATGATCACCTATTTGGCACAGCTG
CATCCCTTGATTCGTACGTATCCTGCTCATGTCGTTGCCATGTCCTCATATATAGAACAGAACCCGTTCATACAA
TAAAAACGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail