Protein ID | AgabiH97|085650 |
Gene name | |
Location | scaffold_5:1858873..1859187 |
Strand | - |
Gene length (bp) | 314 |
Transcript length (bp) | 216 |
Coding sequence length (bp) | 216 |
Protein length (aa) | 72 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF05493 | ATP_synt_H | ATP synthase subunit H | 6.0E-19 | 8 | 65 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q69Z14|VA0E_SCHPO | V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma9 PE=3 SV=2 | 24 | 69 | 1.0E-08 |
sp|Q3E7B6|VA0E_YEAST | V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 | 3 | 67 | 4.0E-08 |
sp|Q20591|VA0E_CAEEL | V-type proton ATPase subunit e OS=Caenorhabditis elegans GN=vha-17 PE=3 SV=2 | 8 | 70 | 3.0E-07 |
sp|Q5K8S8|VA0E_CRYNJ | V-type proton ATPase subunit e OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA9 PE=3 SV=2 | 15 | 67 | 1.0E-06 |
sp|Q9BDP4|VA0E1_CANLF | V-type proton ATPase subunit e 1 OS=Canis lupus familiaris GN=ATP6V0E1 PE=3 SV=3 | 7 | 71 | 1.0E-06 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q69Z14|VA0E_SCHPO | V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma9 PE=3 SV=2 | 24 | 69 | 1.0E-08 |
sp|Q3E7B6|VA0E_YEAST | V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 | 3 | 67 | 4.0E-08 |
sp|Q20591|VA0E_CAEEL | V-type proton ATPase subunit e OS=Caenorhabditis elegans GN=vha-17 PE=3 SV=2 | 8 | 70 | 3.0E-07 |
sp|Q5K8S8|VA0E_CRYNJ | V-type proton ATPase subunit e OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA9 PE=3 SV=2 | 15 | 67 | 1.0E-06 |
sp|Q9BDP4|VA0E1_CANLF | V-type proton ATPase subunit e 1 OS=Canis lupus familiaris GN=ATP6V0E1 PE=3 SV=3 | 7 | 71 | 1.0E-06 |
sp|Q75EU0|VA0E_ASHGO | V-type proton ATPase subunit e OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA9 PE=3 SV=1 | 5 | 67 | 3.0E-06 |
sp|Q8NHE4|VA0E2_HUMAN | V-type proton ATPase subunit e 2 OS=Homo sapiens GN=ATP6V0E2 PE=2 SV=1 | 24 | 71 | 5.0E-06 |
sp|Q2KIB5|VA0E2_BOVIN | V-type proton ATPase subunit e 2 OS=Bos taurus GN=ATP6V0E2 PE=3 SV=1 | 24 | 71 | 5.0E-06 |
sp|Q5EB76|VA0E2_RAT | V-type proton ATPase subunit e 2 OS=Rattus norvegicus GN=Atp6v0e2 PE=3 SV=1 | 24 | 71 | 5.0E-06 |
sp|Q91XE7|VA0E2_MOUSE | V-type proton ATPase subunit e 2 OS=Mus musculus GN=Atp6v0e2 PE=3 SV=1 | 24 | 71 | 5.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0033179 | proton-transporting V-type ATPase, V0 domain | Yes |
GO:0046961 | proton-transporting ATPase activity, rotational mechanism | Yes |
GO:1902600 | proton transmembrane transport | Yes |
GO:0042625 | ATPase-coupled ion transmembrane transporter activity | No |
GO:0006810 | transport | No |
GO:0098660 | inorganic ion transmembrane transport | No |
GO:0022853 | active ion transmembrane transporter activity | No |
GO:0098796 | membrane protein complex | No |
GO:0015399 | primary active transmembrane transporter activity | No |
GO:0022890 | inorganic cation transmembrane transporter activity | No |
GO:0034220 | ion transmembrane transport | No |
GO:0008150 | biological_process | No |
GO:0033177 | proton-transporting two-sector ATPase complex, proton-transporting domain | No |
GO:0022804 | active transmembrane transporter activity | No |
GO:0005575 | cellular_component | No |
GO:0140657 | ATP-dependent activity | No |
GO:0051234 | establishment of localization | No |
GO:0019829 | ATPase-coupled cation transmembrane transporter activity | No |
GO:0005215 | transporter activity | No |
GO:0032991 | protein-containing complex | No |
GO:0042626 | ATPase-coupled transmembrane transporter activity | No |
GO:0051179 | localization | No |
GO:0015078 | proton transmembrane transporter activity | No |
GO:0006811 | ion transport | No |
GO:0015075 | ion transmembrane transporter activity | No |
GO:0009987 | cellular process | No |
GO:0009678 | pyrophosphate hydrolysis-driven proton transmembrane transporter activity | No |
GO:0008324 | cation transmembrane transporter activity | No |
GO:0015318 | inorganic molecular entity transmembrane transporter activity | No |
GO:0055085 | transmembrane transport | No |
GO:0098662 | inorganic cation transmembrane transport | No |
GO:0006812 | cation transport | No |
GO:0003674 | molecular_function | No |
GO:0098655 | cation transmembrane transport | No |
GO:0022857 | transmembrane transporter activity | No |
GO:0044769 | ATPase activity, coupled to transmembrane movement of ions, rotational mechanism | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
Yes | 1 - 24 | 0.5 |
Domain # | Start | End | Length |
---|---|---|---|
1 | 4 | 26 | 22 |
2 | 33 | 55 | 22 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|085650 MPPPLFPILAVLVVVAALVACTAFLVPKGPNQVTIRTALMLTLTAAYLMWMITYLAQLHPLIQPVHTIKTE* |
Coding | >AgabiH97|085650 ATGCCGCCCCCACTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC GTCCCCAAGGGCCCCAACCAGGTCACCATCCGAACCGCGCTCATGCTCACTTTAACGGCTGCATATTTGATGTGG ATGATCACCTATTTGGCACAGCTGCATCCCTTGATTCAACCCGTTCATACAATAAAAACGGAGTGA |
Transcript | >AgabiH97|085650 ATGCCGCCCCCACTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC GTCCCCAAGGGCCCCAACCAGGTCACCATCCGAACCGCGCTCATGCTCACTTTAACGGCTGCATATTTGATGTGG ATGATCACCTATTTGGCACAGCTGCATCCCTTGATTCAACCCGTTCATACAATAAAAACGGAGTGA |
Gene | >AgabiH97|085650 ATGCCGCCCCCACTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC GTCCCCAAGGGCCCCAACCAGGTGTACGTGTTCTGCTCGTCTTCCCTTGCACTTTTCTCACCCGAGCCCTCTAGC ACCATCCGAACCGCGCTCATGCTCACTTTAACGGCTGCATATTTGATGTGGATGATCACCTATTTGGCACAGCTG CATCCCTTGATTCGTACGTATCCTGCTCATGTCGTTGCCATGTCCTCATATATAGAACAGAACCCGTTCATACAA TAAAAACGGAGTGA |