Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085630
Gene name
Locationscaffold_5:1854714..1856243
Strand+
Gene length (bp)1529
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10 8.0E-113 22 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60206|XLNA_AGABI Endo-1,4-beta-xylanase OS=Agaricus bisporus GN=xlnA PE=2 SV=1 1 333 0.0E+00
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 14 331 3.0E-147
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 13 332 2.0E-144
sp|B4XVN1|XYNA_STRSQ Endo-1,4-beta-xylanase A OS=Streptomyces sp. GN=xynAS9 PE=1 SV=1 19 327 1.0E-120
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 1 330 6.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60206|XLNA_AGABI Endo-1,4-beta-xylanase OS=Agaricus bisporus GN=xlnA PE=2 SV=1 1 333 0.0E+00
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 14 331 3.0E-147
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 13 332 2.0E-144
sp|B4XVN1|XYNA_STRSQ Endo-1,4-beta-xylanase A OS=Streptomyces sp. GN=xynAS9 PE=1 SV=1 19 327 1.0E-120
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 1 330 6.0E-119
sp|P07986|GUX_CELFI Exoglucanase/xylanase OS=Cellulomonas fimi GN=cex PE=1 SV=1 11 331 1.0E-101
sp|G4MLU0|XYN5_MAGO7 Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL5 PE=3 SV=1 8 324 1.0E-100
sp|Q8J1Y4|XYN5_MAGGR Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea GN=XYL5 PE=3 SV=1 8 324 1.0E-100
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 22 327 2.0E-95
sp|I1RQU5|XYN1_GIBZE Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYL1 PE=1 SV=1 26 324 2.0E-94
sp|Q2PGV8|XYN2_AURPU Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans GN=xynII PE=1 SV=1 27 328 1.0E-93
sp|B3A0S5|XYNA_FUSO4 Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=FOXG_17421 PE=1 SV=1 26 329 1.0E-93
sp|Q0CBM8|XYNC_ASPTN Probable endo-1,4-beta-xylanase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnC PE=2 SV=2 27 328 5.0E-81
sp|Q4JHP5|XYNC_ASPTE Probable endo-1,4-beta-xylanase C OS=Aspergillus terreus GN=xlnC PE=2 SV=1 27 328 6.0E-81
sp|Q96VB6|XYNF3_ASPOR Endo-1,4-beta-xylanase F3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xynF3 PE=1 SV=1 17 329 3.0E-80
sp|Q0H904|XYNC_ASPFU Endo-1,4-beta-xylanase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnC PE=2 SV=2 27 328 4.0E-80
sp|P23360|XYNA_THEAU Endo-1,4-beta-xylanase OS=Thermoascus aurantiacus GN=XYNA PE=1 SV=4 27 333 4.0E-80
sp|O94163|XYNF1_ASPOR Endo-1,4-beta-xylanase F1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xynF1 PE=1 SV=1 17 330 2.0E-79
sp|A1CX14|XYNC_NEOFI Probable endo-1,4-beta-xylanase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnC PE=2 SV=1 10 328 8.0E-78
sp|B0Y6E0|XYNC_ASPFC Probable endo-1,4-beta-xylanase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnC PE=2 SV=2 27 328 6.0E-77
sp|Q9P8J1|XYNA_TALPU Endo-1,4-beta-xylanase A OS=Talaromyces purpurogenus GN=XynA PE=1 SV=1 27 330 2.0E-75
sp|A1CHQ0|XYNC_ASPCL Probable endo-1,4-beta-xylanase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnC PE=2 SV=1 27 328 5.0E-75
sp|P56588|XYNA_PENSI Endo-1,4-beta-xylanase OS=Penicillium simplicissimum PE=1 SV=1 27 330 3.0E-74
sp|Q5S7A8|XYNA_PENCN Endo-1,4-beta-xylanase A OS=Penicillium canescens GN=xylA PE=1 SV=1 27 330 3.0E-74
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 13 329 3.0E-74
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 13 329 3.0E-74
sp|B8NXJ2|XYNF3_ASPFN Probable endo-1,4-beta-xylanase F3 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xynF3 PE=2 SV=1 17 330 4.0E-74
sp|O59859|XYNA_ASPAC Endo-1,4-beta-xylanase OS=Aspergillus aculeatus GN=xynIA PE=3 SV=1 27 330 4.0E-74
sp|C5J411|XYNC_ASPNG Probable endo-1,4-beta-xylanase C OS=Aspergillus niger GN=xlnC PE=2 SV=2 27 330 7.0E-74
sp|Q00177|XYNC_EMENI Endo-1,4-beta-xylanase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnC PE=1 SV=1 10 332 9.0E-74
sp|A2QFV7|XYNC_ASPNC Probable endo-1,4-beta-xylanase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnC PE=1 SV=1 27 330 1.0E-73
sp|I1S3T9|XYNC_GIBZE Endo-1,4-beta-xylanase C OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLC PE=1 SV=1 3 330 5.0E-73
sp|P33559|XYNA_ASPKW Endo-1,4-beta-xylanase A OS=Aspergillus kawachii (strain NBRC 4308) GN=xynA PE=1 SV=2 27 330 8.0E-73
sp|Q4P902|XIN1_USTMA Endo-1,4-beta-xylanase UM03411 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_03411 PE=1 SV=1 19 328 6.0E-72
sp|Q60041|XYNB_THENE Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana GN=xynB PE=3 SV=1 54 327 3.0E-71
sp|G4MTF8|XYN2_MAGO7 Endo-1,4-beta-xylanase 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL2 PE=3 SV=1 19 328 2.0E-70
sp|P10478|XYNZ_CLOTH Endo-1,4-beta-xylanase Z OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=xynZ PE=1 SV=3 54 327 9.0E-70
sp|B8NER4|XYNF1_ASPFN Probable endo-1,4-beta-xylanase F1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xynF1 PE=3 SV=1 3 328 2.0E-69
sp|W0HFK8|XYN1_RHIOR Endo-1,4-beta-xylanase 1 OS=Rhizopus oryzae GN=xyn1 PE=1 SV=1 27 327 1.0E-67
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 13 329 6.0E-67
sp|Q6PRW6|XYN_PENCH Endo-1,4-beta-xylanase OS=Penicillium chrysogenum GN=Xyn PE=1 SV=1 27 300 1.0E-65
sp|P29417|XYNA_PENCH Endo-1,4-beta-xylanase OS=Penicillium chrysogenum GN=XYLP PE=1 SV=2 27 300 1.0E-65
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 27 303 5.0E-65
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 24 327 1.0E-64
sp|O74717|XYN2_CLAPU Endo-1,4-beta-xylanase 2 OS=Claviceps purpurea GN=xyl2 PE=2 SV=1 19 307 1.0E-63
sp|Q01176|XYN2_MAGGR Endo-1,4-beta-xylanase 2 OS=Magnaporthe grisea GN=XYL2 PE=1 SV=1 19 328 5.0E-63
sp|P36917|XYNA_THESA Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum GN=xynA PE=1 SV=1 28 329 3.0E-54
sp|P38535|XYNX_CLOTM Exoglucanase XynX OS=Clostridium thermocellum GN=xynX PE=3 SV=1 28 329 3.0E-53
sp|P14768|XYNA_CELJU Endo-1,4-beta-xylanase A OS=Cellvibrio japonicus (strain Ueda107) GN=xynA PE=1 SV=2 53 332 3.0E-48
sp|Q59675|XY10C_CELJA Endo-beta-1,4-xylanase Xyn10C OS=Cellvibrio japonicus GN=xyn10C PE=1 SV=2 55 330 9.0E-47
sp|P40943|XYN1_GEOSE Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus PE=1 SV=1 4 329 9.0E-46
sp|Q12603|XYNA_DICTH Beta-1,4-xylanase OS=Dictyoglomus thermophilum GN=xynA PE=3 SV=1 55 328 1.0E-45
sp|O69230|XYNC_PAEBA Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis GN=xynC PE=1 SV=1 22 329 4.0E-45
sp|P07528|XYNA_BACHD Endo-1,4-beta-xylanase A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=xynA PE=1 SV=1 55 329 2.0E-43
sp|O69231|XYNB_PAEBA Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis GN=xynB PE=1 SV=1 55 301 1.0E-41
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 55 301 6.0E-41
sp|C6CRV0|XYNA1_PAESJ Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) GN=xynA1 PE=1 SV=1 58 329 1.0E-40
sp|P10474|GUNB_CALSA Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus GN=celB PE=3 SV=1 55 330 1.0E-39
sp|P40942|CEXY_CLOSR Thermostable celloxylanase OS=Clostridium stercorarium GN=xynB PE=1 SV=1 21 329 1.0E-39
sp|P45703|XYN2_GEOSE Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus GN=xynA PE=1 SV=1 56 329 2.0E-38
sp|P40944|XYNA_CALSR Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor sp. (strain Rt8B.4) GN=xynA PE=3 SV=1 43 303 3.0E-38
sp|Q60037|XYNA_THEMA Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=xynA PE=1 SV=1 52 300 1.0E-34
sp|D5EY13|XYFA_PRER2 Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyn10D-fae1A PE=1 SV=1 26 329 2.0E-34
sp|P49942|XYNA_BACOV Endo-1,4-beta-xylanase A OS=Bacteroides ovatus GN=xylI PE=2 SV=1 54 255 3.0E-34
sp|Q60042|XYNA_THENE Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana GN=xynA PE=1 SV=1 56 300 7.0E-34
sp|P23556|XYNA_CALSA Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus GN=xynA PE=1 SV=1 55 300 1.0E-32
sp|P48789|XYNA_PRERU Endo-1,4-beta-xylanase A OS=Prevotella ruminicola GN=xynA PE=3 SV=1 2 328 2.0E-32
sp|P07529|XYNA_CRYAL Endo-1,4-beta-xylanase OS=Cryptococcus albidus PE=1 SV=2 13 308 2.0E-28
sp|P26223|XYNB_BUTFI Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens GN=xynB PE=3 SV=1 55 328 7.0E-23
sp|P51584|XYNY_CLOTM Endo-1,4-beta-xylanase Y OS=Clostridium thermocellum GN=xynY PE=1 SV=1 54 327 5.0E-21
sp|P29126|XYNA_RUMFL Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens GN=xynA PE=3 SV=1 92 300 9.0E-20
sp|P23557|XYN4_CALSA Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus PE=3 SV=1 64 328 5.0E-19
sp|P23551|XYNA_BUTFI Endo-1,4-beta-xylanase A OS=Butyrivibrio fibrisolvens GN=xynA PE=3 SV=1 78 333 2.0E-16
sp|P23030|XYNB_CELJU Endo-1,4-beta-xylanase B OS=Cellvibrio japonicus (strain Ueda107) GN=xynB PE=1 SV=2 55 303 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085630
MYLVAFMLLAILPTGYCQLNTLAVRAGKKYFGTATDNPELGDAPYVAQLGNTADFNQITAGNSMKWDATEPSRGT
FTFSNGDTVANMARNRGQLLRGHTCVWHSQLPNWVTSGNFDNSTLLSIVQNHCSTLVSHYRGQMCYWDVVNEPFN
EDGSFRQSVFFQKTGTAYIATALRAARNADPNTKLYINDFNIEGTGAKSTGMINLVRSLQQQNVPIDGIGVQAHL
IVGQIPSSIQQNLQNFANLGVEVAITELDIRMTLPVTQQKLEQQQEDYRTVIRACKAVSRCVGVTVWDWTDRYSW
VPGVFNGEGAACPWDENLAKKPAYQGIVDGWSQ*
Coding >AgabiH97|085630
ATGTATCTCGTCGCGTTTATGCTTCTCGCTATACTGCCGACAGGCTATTGCCAACTCAATACGCTTGCCGTACGA
GCTGGAAAGAAATATTTTGGTACTGCAACCGATAATCCTGAATTGGGAGATGCTCCGTATGTTGCCCAACTCGGT
AACACGGCAGATTTCAATCAAATCACCGCGGGAAACAGTATGAAATGGGACGCCACGGAGCCCTCCCGAGGAACT
TTCACCTTTTCAAATGGCGACACAGTTGCCAACATGGCCCGAAACCGTGGGCAGCTTCTCAGAGGGCACACCTGT
GTTTGGCACTCGCAGCTTCCAAACTGGGTCACATCTGGCAATTTTGACAATTCAACCCTTCTAAGCATTGTCCAA
AACCACTGCTCGACTTTAGTCTCCCATTACAGGGGTCAAATGTGTTATTGGGATGTAGTCAATGAGCCGTTCAAC
GAGGATGGCAGCTTTAGGCAATCAGTCTTCTTCCAGAAGACTGGGACCGCTTATATCGCCACAGCACTCCGAGCC
GCTCGTAATGCAGACCCGAACACGAAGCTCTATATCAACGATTTCAACATTGAAGGTACCGGGGCCAAGTCCACT
GGCATGATTAATCTCGTCCGGAGCCTTCAACAGCAGAACGTCCCCATTGACGGCATCGGCGTACAAGCTCACTTG
ATTGTTGGCCAAATTCCTTCCAGTATACAGCAAAATCTACAGAACTTTGCGAACCTCGGAGTAGAAGTCGCAATT
ACTGAGCTTGATATCAGAATGACACTTCCTGTCACACAGCAAAAGCTTGAGCAACAGCAAGAAGATTATCGGACC
GTCATTCGGGCATGCAAGGCTGTTTCCCGCTGCGTCGGTGTTACAGTTTGGGATTGGACTGATAGGTACTCTTGG
GTTCCAGGAGTTTTCAATGGTGAAGGAGCCGCTTGCCCATGGGATGAAAATTTGGCGAAGAAACCCGCATATCAA
GGCATCGTGGATGGCTGGAGTCAATGA
Transcript >AgabiH97|085630
ATGTATCTCGTCGCGTTTATGCTTCTCGCTATACTGCCGACAGGCTATTGCCAACTCAATACGCTTGCCGTACGA
GCTGGAAAGAAATATTTTGGTACTGCAACCGATAATCCTGAATTGGGAGATGCTCCGTATGTTGCCCAACTCGGT
AACACGGCAGATTTCAATCAAATCACCGCGGGAAACAGTATGAAATGGGACGCCACGGAGCCCTCCCGAGGAACT
TTCACCTTTTCAAATGGCGACACAGTTGCCAACATGGCCCGAAACCGTGGGCAGCTTCTCAGAGGGCACACCTGT
GTTTGGCACTCGCAGCTTCCAAACTGGGTCACATCTGGCAATTTTGACAATTCAACCCTTCTAAGCATTGTCCAA
AACCACTGCTCGACTTTAGTCTCCCATTACAGGGGTCAAATGTGTTATTGGGATGTAGTCAATGAGCCGTTCAAC
GAGGATGGCAGCTTTAGGCAATCAGTCTTCTTCCAGAAGACTGGGACCGCTTATATCGCCACAGCACTCCGAGCC
GCTCGTAATGCAGACCCGAACACGAAGCTCTATATCAACGATTTCAACATTGAAGGTACCGGGGCCAAGTCCACT
GGCATGATTAATCTCGTCCGGAGCCTTCAACAGCAGAACGTCCCCATTGACGGCATCGGCGTACAAGCTCACTTG
ATTGTTGGCCAAATTCCTTCCAGTATACAGCAAAATCTACAGAACTTTGCGAACCTCGGAGTAGAAGTCGCAATT
ACTGAGCTTGATATCAGAATGACACTTCCTGTCACACAGCAAAAGCTTGAGCAACAGCAAGAAGATTATCGGACC
GTCATTCGGGCATGCAAGGCTGTTTCCCGCTGCGTCGGTGTTACAGTTTGGGATTGGACTGATAGGTACTCTTGG
GTTCCAGGAGTTTTCAATGGTGAAGGAGCCGCTTGCCCATGGGATGAAAATTTGGCGAAGAAACCCGCATATCAA
GGCATCGTGGATGGCTGGAGTCAATGA
Gene >AgabiH97|085630
ATGTATCTCGTCGCGTTTATGCTTCTCGCTATACTGCCGACAGGCTATTGCCAACTCAATACGCTTGCCGTACGA
GCTGGAAAGAAATATTTTGGTACTGCAACCGATAATCCTGAATTGGGAGATGCTCCGTATGTTGCCCAACTCGGT
AACACGGCAGATTTCAATCAAATCACCGCGGTGAGTATATACCGTGGATCAATGGAGCTCGCTATCTGATAAGTC
ATGTAGGGAAACAGTATGAAATGGGTGCGACCGTTTCTATGGTCTAAAAAACACTCTTGAGTTATAACTTCATCT
CAGGACGCCACGGAGCCCTCCCGAGGAACTTTCACCTTTTCAAATGGCGACACAGTTGCCAACATGGCCCGAAAC
CGTGGGCAGCTTCTCAGAGGTTCTTGAATAGTATAATCTACTGTTGCTGGATCCCGTCATTGACTGCCGTCTAGG
GCACACCTGTGTTTGGCACTCGCAGCTTCCAAACTGGGTCACATCTGGCAATTTTGACAATTCAACCCTTCTAAG
GTGCCCGACACTTGAACCCATATCAACGTTCAAAATTTGATTCACTCCACCTAGCATTGTCCAAAACCACTGCTC
GACTTTAGTCTCCCATTACAGGGGTCAAATGTACGTTCGAACCTCTTTCAGTAACGTCAAGGACTGACGAATTAT
CTTTAATAGGTGTTAGTACAATCTGTCAAACTAGCCTCATTCGCTACTCATCAACTTGCGCCCTATAGACAGTTG
GGATGTAGTCAATGGTTCGACTCAGGTTTAATATTTCTACTTGATCCGACATGACTCAATTTTTAGAGCCGTTCA
ACGAGGATGGCAGCTTTAGGCAATCAGTCTTCTTCCAGAAGACTGGGACCGCTTATATCGCCACAGCACTCCGAG
CCGCTCGTAATGCAGACCCGAACACGAAGCTCTATGTAAGCACCTTCGTCGAATCTGAACGAGTTTGCTCAACTA
CGCGCAGATCAACGATTTCAACATTGAAGGTACCGGGGCCAAGTCCACTGGCATGATTAATCTCGTCCGGAGCCT
TCAACAGCAGAACGTCCCCATTGACGGCATCGGCGTACAAGCTCACTTGATTGTTGGCCAAATTCCTTCCAGTAT
ACAGCAAAATCTACAGAACTTTGCGAACCTCGGAGTAGAAGTCGCAATTACTGAGCTTGATATCAGAATGACACT
TCCTGTCACACAGCAAAAGCTTGAGCAACAGCAAGAAGATTATCGGACCGTCATTCGGGCATGCAAGGCTGTTTC
CCGCTGCGTCGGTGTTACAGTTTGGGATTGGACTGATAGGGTGGGTTGTTTTGATTTGATGTCGCAACCGCATGT
ATTTACACCCCTTAGTACTCTTGGGTTCCAGGAGTTTTCAATGGTGAAGGAGCCGCTTGCCCATGGGATGAAGTG
AGCTTTTTCGATATAAACCCCCTTTTAGAAGCGTACTGACAATTGAAAAGAATTTGGCGAAGAAACCCGCATATC
AAGGCATCGTGGATGGCTGGAGTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail