Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085580
Gene name
Locationscaffold_5:1838387..1840456
Strand-
Gene length (bp)2069
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 1.4E-46 81 406

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q31125|S39A7_MOUSE Zinc transporter SLC39A7 OS=Mus musculus GN=Slc39a7 PE=1 SV=2 85 382 8.0E-48
sp|Q9XUC4|HKE41_CAEEL Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis elegans GN=hke-4.1 PE=2 SV=2 71 409 1.0E-46
sp|A8WMY3|HKE41_CAEBR Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis briggsae GN=hke-4.1 PE=3 SV=2 71 409 1.0E-45
sp|Q5TJF6|S39A7_CANLF Zinc transporter SLC39A7 OS=Canis lupus familiaris GN=SLC39A7 PE=3 SV=1 59 382 3.0E-42
sp|Q9XTQ7|HKE42_CAEEL Histidine-rich membrane protein KE4 homolog 2 OS=Caenorhabditis elegans GN=hke-4.2 PE=3 SV=2 81 409 5.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q31125|S39A7_MOUSE Zinc transporter SLC39A7 OS=Mus musculus GN=Slc39a7 PE=1 SV=2 85 382 8.0E-48
sp|Q9XUC4|HKE41_CAEEL Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis elegans GN=hke-4.1 PE=2 SV=2 71 409 1.0E-46
sp|A8WMY3|HKE41_CAEBR Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis briggsae GN=hke-4.1 PE=3 SV=2 71 409 1.0E-45
sp|Q5TJF6|S39A7_CANLF Zinc transporter SLC39A7 OS=Canis lupus familiaris GN=SLC39A7 PE=3 SV=1 59 382 3.0E-42
sp|Q9XTQ7|HKE42_CAEEL Histidine-rich membrane protein KE4 homolog 2 OS=Caenorhabditis elegans GN=hke-4.2 PE=3 SV=2 81 409 5.0E-41
sp|Q92504|S39A7_HUMAN Zinc transporter SLC39A7 OS=Homo sapiens GN=SLC39A7 PE=1 SV=2 59 406 2.0E-40
sp|P40544|YKE4_YEAST Zinc transporter YKE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKE4 PE=1 SV=1 72 404 2.0E-39
sp|Q5RFD5|S39A7_PONAB Zinc transporter SLC39A7 OS=Pongo abelii GN=SLC39A7 PE=2 SV=1 59 382 5.0E-38
sp|A8X482|HKE42_CAEBR Histidine-rich membrane protein KE4 homolog 2 OS=Caenorhabditis briggsae GN=hke-4.2 PE=3 SV=2 82 409 2.0E-37
sp|Q9VAF0|S39AD_DROME Zinc transporter ZIP13 homolog OS=Drosophila melanogaster GN=Zip99C PE=2 SV=1 73 402 1.0E-36
sp|Q9V3A4|CSUP_DROME Protein catecholamines up OS=Drosophila melanogaster GN=Catsup PE=2 SV=1 80 406 3.0E-35
sp|Q9UT11|YLW3_SCHPO Uncharacterized zinc transporter P8A3.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.03 PE=3 SV=1 73 380 5.0E-35
sp|Q2M1K6|S39AD_RAT Zinc transporter ZIP13 OS=Rattus norvegicus GN=Slc39a13 PE=2 SV=1 84 381 2.0E-31
sp|Q5ZI20|S39AD_CHICK Zinc transporter ZIP13 OS=Gallus gallus GN=SLC39A13 PE=2 SV=1 81 408 4.0E-31
sp|Q8BZH0|S39AD_MOUSE Zinc transporter ZIP13 OS=Mus musculus GN=Slc39a13 PE=2 SV=1 84 406 5.0E-31
sp|Q8AW42|S39AD_DANRE Zinc transporter ZIP13 OS=Danio rerio GN=slc39a13 PE=2 SV=1 108 406 1.0E-30
sp|Q96H72|S39AD_HUMAN Zinc transporter ZIP13 OS=Homo sapiens GN=SLC39A13 PE=1 SV=3 81 404 3.0E-28
sp|Q9PUB8|S39A7_DANRE Zinc transporter Slc39a7 (Fragment) OS=Danio rerio GN=slc39a7 PE=2 SV=1 80 291 2.0E-27
sp|A5D7H1|S39AD_BOVIN Zinc transporter ZIP13 OS=Bos taurus GN=SLC39A13 PE=2 SV=1 81 404 2.0E-26
sp|Q504Y0|S39AC_HUMAN Zinc transporter ZIP12 OS=Homo sapiens GN=SLC39A12 PE=2 SV=3 108 378 8.0E-25
sp|Q9M647|IAR1_ARATH IAA-alanine resistance protein 1 OS=Arabidopsis thaliana GN=IAR1 PE=1 SV=3 96 384 2.0E-24
sp|Q5R6I6|S39AD_PONAB Zinc transporter ZIP13 OS=Pongo abelii GN=SLC39A13 PE=2 SV=1 233 404 3.0E-24
sp|Q08E40|S39AC_BOVIN Zinc transporter ZIP12 OS=Bos taurus GN=SLC39A12 PE=2 SV=1 108 409 2.0E-20
sp|Q95KA5|S39AC_MACFA Zinc transporter ZIP12 OS=Macaca fascicularis GN=SLC39A12 PE=2 SV=1 108 321 3.0E-20
sp|Q5FWH7|S39AC_MOUSE Zinc transporter ZIP12 OS=Mus musculus GN=Slc39a12 PE=1 SV=1 108 378 6.0E-20
sp|A4IGY6|S39AE_XENTR Zinc transporter ZIP14 OS=Xenopus tropicalis GN=slc39a14 PE=2 SV=1 113 394 9.0E-19
sp|A0JPN2|S39A4_RAT Zinc transporter ZIP4 OS=Rattus norvegicus GN=Slc39a4 PE=2 SV=1 108 340 2.0E-18
sp|Q78IQ7|S39A4_MOUSE Zinc transporter ZIP4 OS=Mus musculus GN=Slc39a4 PE=1 SV=1 108 340 7.0E-18
sp|Q9VSL7|FOI_DROME Zinc transporter foi OS=Drosophila melanogaster GN=foi PE=1 SV=3 239 409 3.0E-17
sp|Q75N73|S39AE_MOUSE Zinc transporter ZIP14 OS=Mus musculus GN=Slc39a14 PE=1 SV=1 95 340 1.0E-16
sp|Q91W10|S39A8_MOUSE Zinc transporter ZIP8 OS=Mus musculus GN=Slc39a8 PE=2 SV=1 108 337 1.0E-16
sp|Q6P5F6|S39AA_MOUSE Zinc transporter ZIP10 OS=Mus musculus GN=Slc39a10 PE=1 SV=1 236 409 2.0E-16
sp|Q9ULF5|S39AA_HUMAN Zinc transporter ZIP10 OS=Homo sapiens GN=SLC39A10 PE=1 SV=2 236 409 2.0E-16
sp|Q6PEH9|S39AA_DANRE Zinc transporter ZIP10 OS=Danio rerio GN=slc39a10 PE=2 SV=1 236 406 3.0E-16
sp|A5D7L5|S39AE_BOVIN Zinc transporter ZIP14 OS=Bos taurus GN=SLC39A14 PE=2 SV=1 95 340 3.0E-16
sp|Q5FVQ0|S39A8_RAT Zinc transporter ZIP8 OS=Rattus norvegicus GN=Slc39a8 PE=2 SV=1 108 337 4.0E-16
sp|Q15043|S39AE_HUMAN Zinc transporter ZIP14 OS=Homo sapiens GN=SLC39A14 PE=1 SV=3 95 340 4.0E-16
sp|Q1KZG0|S39A4_BOVIN Zinc transporter ZIP4 OS=Bos taurus GN=SLC39A4 PE=1 SV=1 113 379 8.0E-16
sp|Q5RAB7|S39AE_PONAB Zinc transporter ZIP14 OS=Pongo abelii GN=SLC39A14 PE=2 SV=2 95 340 1.0E-15
sp|Q9D856|S39A5_MOUSE Zinc transporter ZIP5 OS=Mus musculus GN=Slc39a5 PE=1 SV=1 108 383 2.0E-14
sp|Q5R9M9|S39A6_PONAB Zinc transporter ZIP6 OS=Pongo abelii GN=SLC39A6 PE=2 SV=1 236 406 1.0E-13
sp|Q13433|S39A6_HUMAN Zinc transporter ZIP6 OS=Homo sapiens GN=SLC39A6 PE=1 SV=3 236 406 1.0E-13
sp|Q8C145|S39A6_MOUSE Zinc transporter ZIP6 OS=Mus musculus GN=Slc39a6 PE=1 SV=1 236 384 2.0E-13
sp|Q4V887|S39A6_RAT Zinc transporter ZIP6 OS=Rattus norvegicus GN=Slc39a6 PE=1 SV=1 236 384 2.0E-13
sp|Q6ZMH5|S39A5_HUMAN Zinc transporter ZIP5 OS=Homo sapiens GN=SLC39A5 PE=1 SV=3 111 294 4.0E-12
sp|Q6P5W5|S39A4_HUMAN Zinc transporter ZIP4 OS=Homo sapiens GN=SLC39A4 PE=1 SV=3 108 380 2.0E-11
sp|Q9C0K1|S39A8_HUMAN Zinc transporter ZIP8 OS=Homo sapiens GN=SLC39A8 PE=2 SV=1 237 337 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0008324 cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0015075 ion transmembrane transporter activity No
GO:0006811 ion transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 151 168 17
2 255 277 22
3 305 327 22
4 357 379 22
5 388 407 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085580
MTLRFTHYLVIACLLACLTWRSNATTAPNTGGILTVSEADLHKCSAVQKLSALKVAVDEQESPIMRQVFAWLFPF
GPAGNSILGTFYISSVPNFILAFIPAQINGNTLNTMTAFAAGGLLSDVLLHLVPHSFMGEHQDPGVHFVMVEEKR
NILIGLGLFAGFAAFFVMEKTLRVLSGDDEGGHSHSHSHSLKDECDSAETTAVNNSMSQNGLRSRKGEKVKEDTV
QPVKASSGPTATSAYLNLFGDFVHNITDGIAMAASFYASPLVGATTTLACFAHEIPHEIADYSILIRSGFTKKQA
MQSQFLTAIGAFVGTFIGIAVHNAASAGGGSMIIDLAAGVRQDATGLLGTTVQLSDLVIPFVAGGFLYIGAVAVL
PTLLEESKSAKQAIREFAAMGFGVVCMFLVAWNE*
Coding >AgabiH97|085580
ATGACTCTCCGATTCACTCATTATCTCGTCATCGCCTGTCTTTTGGCTTGCCTAACCTGGCGCTCAAATGCCACC
ACCGCACCCAACACAGGTGGTATCCTGACGGTGTCCGAAGCCGATTTACACAAATGCTCTGCCGTGCAAAAGCTT
AGTGCTCTCAAGGTTGCGGTGGACGAGCAGGAGTCACCTATTATGCGTCAGGTCTTCGCGTGGTTGTTCCCTTTC
GGTCCTGCTGGGAATTCTATCCTCGGCACTTTTTATATAAGCTCGGTACCCAACTTTATACTTGCTTTCATACCC
GCGCAAATTAATGGCAATACTCTTAATACCATGACTGCATTTGCTGCTGGAGGCCTGCTTTCAGACGTACTCCTT
CACCTCGTGCCACATTCATTCATGGGTGAACATCAAGACCCTGGTGTTCATTTTGTGATGGTTGAAGAGAAAAGA
AACATCCTCATCGGACTCGGGCTCTTTGCTGGGTTTGCGGCGTTTTTCGTTATGGAAAAGACACTACGTGTTCTG
AGTGGAGACGATGAGGGAGGGCATTCTCATTCTCATTCTCATTCACTCAAGGATGAGTGTGATAGTGCTGAAACG
ACTGCTGTGAATAACTCTATGTCACAAAACGGATTGCGGTCGAGGAAAGGCGAGAAGGTAAAGGAAGATACTGTT
CAACCCGTTAAAGCCTCTTCCGGACCAACAGCAACCTCAGCTTATCTGAATCTTTTCGGAGATTTTGTGCATAAT
ATAACAGATGGTATAGCCATGGCCGCATCTTTCTATGCGTCTCCTCTTGTTGGCGCTACCACGACGTTGGCTTGC
TTTGCACATGAAATCCCACATGAAATAGCCGATTACTCGATATTGATTCGCAGTGGGTTTACAAAAAAGCAAGCC
ATGCAGTCACAGTTTTTGACAGCGATTGGTGCATTTGTTGGGACATTTATTGGTATTGCGGTGCATAATGCTGCG
TCGGCCGGTGGTGGGTCAATGATCATTGACTTGGCCGCGGGGGTGAGGCAAGACGCGACGGGGTTACTCGGCACC
ACAGTGCAACTGTCTGATCTGGTCATCCCATTTGTGGCGGGAGGGTTTTTATATATAGGTGCAGTGGCCGTTTTA
CCTACGCTACTAGAAGAGAGCAAGAGTGCCAAACAAGCGATCCGAGAGTTCGCCGCGATGGGATTTGGGGTCGTG
TGCATGTTTTTGGTCGCGTGGAATGAATAG
Transcript >AgabiH97|085580
ATGACTCTCCGATTCACTCATTATCTCGTCATCGCCTGTCTTTTGGCTTGCCTAACCTGGCGCTCAAATGCCACC
ACCGCACCCAACACAGGTGGTATCCTGACGGTGTCCGAAGCCGATTTACACAAATGCTCTGCCGTGCAAAAGCTT
AGTGCTCTCAAGGTTGCGGTGGACGAGCAGGAGTCACCTATTATGCGTCAGGTCTTCGCGTGGTTGTTCCCTTTC
GGTCCTGCTGGGAATTCTATCCTCGGCACTTTTTATATAAGCTCGGTACCCAACTTTATACTTGCTTTCATACCC
GCGCAAATTAATGGCAATACTCTTAATACCATGACTGCATTTGCTGCTGGAGGCCTGCTTTCAGACGTACTCCTT
CACCTCGTGCCACATTCATTCATGGGTGAACATCAAGACCCTGGTGTTCATTTTGTGATGGTTGAAGAGAAAAGA
AACATCCTCATCGGACTCGGGCTCTTTGCTGGGTTTGCGGCGTTTTTCGTTATGGAAAAGACACTACGTGTTCTG
AGTGGAGACGATGAGGGAGGGCATTCTCATTCTCATTCTCATTCACTCAAGGATGAGTGTGATAGTGCTGAAACG
ACTGCTGTGAATAACTCTATGTCACAAAACGGATTGCGGTCGAGGAAAGGCGAGAAGGTAAAGGAAGATACTGTT
CAACCCGTTAAAGCCTCTTCCGGACCAACAGCAACCTCAGCTTATCTGAATCTTTTCGGAGATTTTGTGCATAAT
ATAACAGATGGTATAGCCATGGCCGCATCTTTCTATGCGTCTCCTCTTGTTGGCGCTACCACGACGTTGGCTTGC
TTTGCACATGAAATCCCACATGAAATAGCCGATTACTCGATATTGATTCGCAGTGGGTTTACAAAAAAGCAAGCC
ATGCAGTCACAGTTTTTGACAGCGATTGGTGCATTTGTTGGGACATTTATTGGTATTGCGGTGCATAATGCTGCG
TCGGCCGGTGGTGGGTCAATGATCATTGACTTGGCCGCGGGGGTGAGGCAAGACGCGACGGGGTTACTCGGCACC
ACAGTGCAACTGTCTGATCTGGTCATCCCATTTGTGGCGGGAGGGTTTTTATATATAGGTGCAGTGGCCGTTTTA
CCTACGCTACTAGAAGAGAGCAAGAGTGCCAAACAAGCGATCCGAGAGTTCGCCGCGATGGGATTTGGGGTCGTG
TGCATGTTTTTGGTCGCGTGGAATGAATAG
Gene >AgabiH97|085580
ATGACTCTCCGATTCACTCATTATCTCGTCATCGCCTGTCTTTTGGCTTGCCTAACCTGGCGCTCAAATGCCACC
ACCGCACCCAACACAGGTGGTATCCTGACGGTGTCCGTGAGTCATACATTTGGTGGCTCGTGTCGAATGTAAAAC
TGTTCTAGATGAACTCAAAAAGACTGATTTGATTACCCCTGGGGGATGTTTAGGAAGCCGATTTACACAAATGCT
CTGCCGTGCAAAAGCTTAGTGCTCTCAAGGTTGCGGTGGACGAGCAGGAGTCACCTATTATGCGTCAGGTCTTCG
CGTGGTTGTTCCCTTTCGGTCCTGCTGGGAATTCTATCCTCGGCACTTTTTATATAAGCTCGTACGTTCGTTTCG
AAAAACCAAATATTTTTTTTTGCTTGCTTCAACTCATGGATTGGAACTCGTGTGATCATTCCAATGATTTAGGGT
ACCCAACTTTATACTTGCTTTCATACCCGCGCAAATTAATGGCAATACTCTTAATACCATGACTGCATTTGCTGT
AAGTGGGGGTTTTGGTTTTTGGTTGAAGAAATGTTGACGTATGGTTTTTCGAAGGCTGGAGGCCTGCTTTCAGAC
GTACTCCTTCACCTCGTGCCACATTCATTCATGGGTGAACATCAAGACCCTGGTGTTCATTTTGTGATGGTTGAA
GAGAAAAGAAACATCCTCATCGGGTCCGTCGAATTCCTAAACTCTAAGGAAATCTATTAATTAGTTGACGCAAAT
GTGAATTTTTAGACTCGGGCTCTTTGCTGGGTTTGCGGCGTTTTTCGTTATGGAAAAGACACTACGTGTTCTGAG
TGGAGACGATGAGGGAGGGCATTCTCATTCTCATTCTCATTCACTCAAGGATGAGTGTGATAGTGCTGAAACGAC
TGCTGTGAATAACTCTATGTCACAAAACGGATTGCGGTCGAGGAAAGGCGAGAAGGTAAAGGAAGATACTGTTCA
ACCCGTTAAAGCCTCTTCCGGACCAACAGCAACCTCAGCTTATCTGAATCTTTTCGGAGATTTTGTGCATAATAT
GTGCGTTAAACGGCCAAAATGCCTCGATGAATTATAGTGCTGATATGAAATTTGTTTTAGAACAGATGGTATAGC
GTACGTCATTCCCAAGTTTCAACCCGTCATGATGAAATATAACTCTTTATAGCATGGCCGCATCTTTCTATGCGT
CTCCTCTTGTTGGCGCTACCACGACGTTGGCTTGCTTTGCACATGAAATCCCACATGAAATAGCCGATTACTCGA
TATTGATTCGCAGTGGGTTTACAAAAAAGCAAGCCATGCAGTCACAGTTTTTGACAGCGATTGGTGCATTTGTGG
GTTTCCCCTTTTGACATTGGAAGACTCATTACTTGATCTTATATATTGTATCACAGGTTGGGTAAGTGTTATTCG
CTAAAAATAACACGCTCGTTGGTAACTTTTATTGTGTTAGGACATTTATTGGTATTGCGGTGCATAATGCTGCGT
CGGCCGGTGGTGGGTCAATGATCATTGACTTGGCCGCGGGGGTGAGGCAAGACGCGACGGGGTTACTCGGCACCA
CAGTGCAACTGTCTGATCTGGTACGTCGATCGTCATCCAATAGCTGCATTCCAAAGCCACCGACGGGCAAACGTT
CGTGATTGGATCAGAACTCATCCCCATTTCTTGTTTGCAGGTCATCCCATTTGTGGCGGGAGGGTTTTTATATAT
AGGTGCAGTGGCCGTTTTACCTACGTATGTGGAATTTAGATCTATTAAAAGTTGTGGTCCCGCCGTGTGATCTTG
CCTGATTCTTCGCGAGACGCATTTGTCGATTCACTTGACCTGACTTTTTTGTTTGTAGGCTACTAGAAGAGAGCA
AGAGTGCCAAACAAGCGATCCGAGAGGTAAGGGTGGTTTTTTGTGTTACGGGCATCCGGCACTCACACGAGTTGA
CAGTTCGCCGCGATGGGATTTGGGGTCGTGTGCATGTTTTTGGTCGCGTGAGTGTTCATTGCGGGTGTACTACGA
GGTGCAGTGGCTTAACAATGAGCATTGACAGGTGGAATGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail