Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085570
Gene name
Locationscaffold_5:1837518..1838141
Strand-
Gene length (bp)623
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 7.9E-13 38 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q566C7|NUDT3_RAT Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Rattus norvegicus GN=Nudt3 PE=1 SV=1 29 143 2.0E-12
sp|O95989|NUDT3_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens GN=NUDT3 PE=1 SV=1 29 143 8.0E-12
sp|Q09790|APS1_SCHPO Diphosphoinositol polyphosphate phosphohydrolase aps1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aps1 PE=1 SV=1 27 156 1.0E-11
sp|Q58CW0|NUD11_BOVIN Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Bos taurus GN=NUDT11 PE=2 SV=2 48 153 1.0E-11
sp|Q9JI46|NUDT3_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Mus musculus GN=Nudt3 PE=1 SV=1 29 142 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q566C7|NUDT3_RAT Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Rattus norvegicus GN=Nudt3 PE=1 SV=1 29 143 2.0E-12
sp|O95989|NUDT3_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens GN=NUDT3 PE=1 SV=1 29 143 8.0E-12
sp|Q09790|APS1_SCHPO Diphosphoinositol polyphosphate phosphohydrolase aps1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aps1 PE=1 SV=1 27 156 1.0E-11
sp|Q58CW0|NUD11_BOVIN Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Bos taurus GN=NUDT11 PE=2 SV=2 48 153 1.0E-11
sp|Q9JI46|NUDT3_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Mus musculus GN=Nudt3 PE=1 SV=1 29 142 2.0E-11
sp|Q5RAF0|NUDT4_PONAB Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Pongo abelii GN=NUDT4 PE=2 SV=1 21 157 3.0E-11
sp|Q9NZJ9|NUDT4_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens GN=NUDT4 PE=1 SV=2 21 157 3.0E-11
sp|Q8NFP7|NUD10_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Homo sapiens GN=NUDT10 PE=1 SV=1 48 142 4.0E-11
sp|Q99MY2|NUDT4_RAT Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Rattus norvegicus GN=Nudt4 PE=2 SV=1 21 142 4.0E-11
sp|Q8R2U6|NUDT4_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Mus musculus GN=Nudt4 PE=1 SV=1 21 155 4.0E-11
sp|P0C028|NUD11_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Mus musculus GN=Nudt11 PE=1 SV=1 48 142 5.0E-11
sp|P0C027|NUD10_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Mus musculus GN=Nudt10 PE=1 SV=1 48 142 5.0E-11
sp|Q96G61|NUD11_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Homo sapiens GN=NUDT11 PE=1 SV=1 34 142 6.0E-11
sp|A2VE79|NUDT3_BOVIN Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Bos taurus GN=NUDT3 PE=2 SV=1 29 142 7.0E-11
sp|Q99321|DDP1_YEAST Diphosphoinositol polyphosphate phosphohydrolase DDP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DDP1 PE=1 SV=3 34 141 1.0E-09
sp|Q8VY81|NUD21_ARATH Nudix hydrolase 21, chloroplastic OS=Arabidopsis thaliana GN=NUDT21 PE=2 SV=1 48 138 1.0E-09
sp|Q93ZY7|NUD12_ARATH Nudix hydrolase 12, mitochondrial OS=Arabidopsis thaliana GN=NUDT12 PE=2 SV=1 48 143 2.0E-08
sp|Q52K88|NUD13_ARATH Nudix hydrolase 13, mitochondrial OS=Arabidopsis thaliana GN=NUDT13 PE=1 SV=1 48 153 1.0E-07
sp|Q9LQU5|NUD18_ARATH Nudix hydrolase 18, mitochondrial OS=Arabidopsis thaliana GN=NUDT18 PE=2 SV=1 48 158 3.0E-07
sp|Q9ZU95|NUD17_ARATH Nudix hydrolase 17, mitochondrial OS=Arabidopsis thaliana GN=NUDT17 PE=2 SV=1 48 137 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085570
MTSSSTVANSSFIPKLLYPHSYSLMGTKGRSTPRVVCCAIPIARSAGKVLVVTSRKRPDYWVLPKGGWEPTDVQL
EAAASREAFEEAGVRGTVTRYVITIPTPSATYHFYELDVAGLEQDWLESNERRREWVDYAEAVRRLEWKSELAQG
LKLCSLAPCR*
Coding >AgabiH97|085570
ATGACTTCAAGCTCCACCGTAGCCAACTCGTCCTTCATCCCCAAGCTTCTCTATCCTCATTCATACTCCCTCATG
GGTACAAAGGGCCGCTCCACTCCGCGCGTTGTCTGCTGCGCCATCCCTATCGCTAGATCCGCCGGAAAAGTGTTG
GTGGTCACAAGTCGCAAAAGGCCAGATTACTGGGTCTTGCCCAAAGGTGGATGGGAACCCACCGATGTGCAGCTA
GAGGCTGCTGCCTCACGAGAGGCCTTTGAAGAAGCCGGTGTACGCGGAACGGTCACTCGCTATGTGATAACAATA
CCAACCCCTTCGGCGACTTACCATTTCTATGAATTGGATGTCGCCGGACTCGAGCAAGATTGGCTTGAATCCAAC
GAACGAAGACGAGAGTGGGTAGATTATGCTGAAGCTGTCCGCCGCCTTGAATGGAAGTCGGAGCTCGCACAAGGT
CTCAAACTTTGTTCCTTGGCTCCTTGCCGTTAG
Transcript >AgabiH97|085570
ATGACTTCAAGCTCCACCGTAGCCAACTCGTCCTTCATCCCCAAGCTTCTCTATCCTCATTCATACTCCCTCATG
GGTACAAAGGGCCGCTCCACTCCGCGCGTTGTCTGCTGCGCCATCCCTATCGCTAGATCCGCCGGAAAAGTGTTG
GTGGTCACAAGTCGCAAAAGGCCAGATTACTGGGTCTTGCCCAAAGGTGGATGGGAACCCACCGATGTGCAGCTA
GAGGCTGCTGCCTCACGAGAGGCCTTTGAAGAAGCCGGTGTACGCGGAACGGTCACTCGCTATGTGATAACAATA
CCAACCCCTTCGGCGACTTACCATTTCTATGAATTGGATGTCGCCGGACTCGAGCAAGATTGGCTTGAATCCAAC
GAACGAAGACGAGAGTGGGTAGATTATGCTGAAGCTGTCCGCCGCCTTGAATGGAAGTCGGAGCTCGCACAAGGT
CTCAAACTTTGTTCCTTGGCTCCTTGCCGTTAG
Gene >AgabiH97|085570
ATGACTTCAAGCTCCACCGTAGCCAACTCGTCCTTCATCCCCAAGCTTCTCTATCCTCATTCATACTCCCTCATG
GGTACAAAGGGCCGCTCCACTCCGCGCGTTGTCTGCTGCGCCATCCCTATCGCTAGATCCGCCGGAAAAGTGTTG
GTGGTCACAAGTCGCAAAAGGCCAGATTACTGGGTCTGTGAGTGACTCTTTCCCTTTCCCTATCGTCCCCTCCAT
TTATCACTCACATGATCACTTTCTTCAGTGCCCAAAGGTGGATGGGAACCCACCGATGTGCAGCTAGAGGCTGCT
GCCTCACGAGAGGCCTTTGAAGAAGGTCCTCCCCATTTCCTCTAATCCGTCGCGCAACTCCTGATTCTCGTCCTC
TTCCCCTGCCGCCGCCGTCTACAGCCGGTGTACGCGGAACGGTCACTCGCTATGTGATAACAATACCAACCCCTT
CGGCGACTTACCATTTCTATGAATTGGATGTCGCCGGACTCGAGCAAGATTGGCTTGAATCCAACGAACGAAGAC
GAGAGTGGGTAGATTATGCTGAAGCTGTCCGCCGCCTTGAATGGAAGTCGGAGCTCGCACAAGGTCTCAAACTTT
GTTCCTTGGCTCCTTGCCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail