Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085540
Gene name
Locationscaffold_5:1828684..1829957
Strand-
Gene length (bp)1273
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.6E-10 59 301
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 8.8E-08 57 139
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.0E-07 57 169

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 33 137 3.0E-06
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 33 137 3.0E-06
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 33 137 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085540
MFSIWPKGANLRFSSLDSPGYSFMAGDLEVNTSRLVKSADGTEIYTDATGNRSPSTPVLVLVHGLFMNKGAFNPI
FDDPKWTSSLFLVRYDTRGHGRSGKSVAEEAWESKRFSEDFEAVCREFEVREAYVLGWSMGAALFPDIMTYTTSV
KILGFINVAGVVSVDPSIKRSSSRPLANEWGGILLSPPSVDAFQEALFQFLHICSDELSPELFRILLEGMIMQPR
GAAVLAFKRKQNPEKMLQEARGGRLPLLGISGLKDKGLIAEELKRELENLGWKRMTYRFLQDADHIPWVSCAEEF
REIVLTWIKELTP*
Coding >AgabiH97|085540
ATGTTCTCCATTTGGCCAAAGGGAGCTAATCTAAGGTTTTCATCCCTTGATTCACCCGGATACTCCTTCATGGCC
GGAGACTTGGAAGTGAATACCTCTCGCTTAGTGAAGTCAGCTGATGGTACGGAAATATATACGGACGCGACAGGA
AACCGCTCGCCGAGCACCCCAGTCCTCGTTTTGGTCCATGGTCTTTTCATGAACAAAGGCGCATTCAATCCTATC
TTCGACGATCCCAAATGGACCTCTAGTCTCTTCCTAGTGCGGTACGATACCCGTGGACATGGTAGAAGCGGAAAA
TCGGTTGCCGAGGAAGCCTGGGAATCCAAACGGTTTTCGGAAGATTTTGAAGCTGTTTGCAGAGAATTCGAAGTA
AGAGAAGCATATGTCTTGGGATGGAGTATGGGTGCCGCTCTGTTCCCTGATATTATGACCTACACCACTTCAGTC
AAGATACTTGGCTTCATTAATGTCGCGGGAGTCGTATCCGTGGACCCCTCGATCAAACGAAGCTCATCTCGTCCA
TTGGCAAATGAATGGGGGGGTATACTCCTATCCCCTCCTTCCGTAGATGCCTTCCAAGAAGCTTTATTTCAATTC
CTCCATATATGCTCTGACGAGCTCTCTCCAGAGCTCTTCCGCATTTTACTGGAAGGAATGATCATGCAGCCACGC
GGCGCAGCGGTGTTGGCTTTTAAAAGAAAACAGAATCCCGAGAAGATGTTGCAGGAGGCGCGAGGTGGGAGACTT
CCACTCCTGGGCATCAGCGGCTTAAAGGATAAAGGATTGATTGCTGAGGAATTGAAAAGAGAGTTGGAAAACTTG
GGGTGGAAAAGGATGACCTATCGGTTTTTGCAAGACGCGGATCATATCCCTTGGGTGTCTTGTGCAGAAGAGTTT
AGAGAAATTGTATTGACGTGGATCAAGGAGTTAACGCCATAA
Transcript >AgabiH97|085540
ATGTTCTCCATTTGGCCAAAGGGAGCTAATCTAAGGTTTTCATCCCTTGATTCACCCGGATACTCCTTCATGGCC
GGAGACTTGGAAGTGAATACCTCTCGCTTAGTGAAGTCAGCTGATGGTACGGAAATATATACGGACGCGACAGGA
AACCGCTCGCCGAGCACCCCAGTCCTCGTTTTGGTCCATGGTCTTTTCATGAACAAAGGCGCATTCAATCCTATC
TTCGACGATCCCAAATGGACCTCTAGTCTCTTCCTAGTGCGGTACGATACCCGTGGACATGGTAGAAGCGGAAAA
TCGGTTGCCGAGGAAGCCTGGGAATCCAAACGGTTTTCGGAAGATTTTGAAGCTGTTTGCAGAGAATTCGAAGTA
AGAGAAGCATATGTCTTGGGATGGAGTATGGGTGCCGCTCTGTTCCCTGATATTATGACCTACACCACTTCAGTC
AAGATACTTGGCTTCATTAATGTCGCGGGAGTCGTATCCGTGGACCCCTCGATCAAACGAAGCTCATCTCGTCCA
TTGGCAAATGAATGGGGGGGTATACTCCTATCCCCTCCTTCCGTAGATGCCTTCCAAGAAGCTTTATTTCAATTC
CTCCATATATGCTCTGACGAGCTCTCTCCAGAGCTCTTCCGCATTTTACTGGAAGGAATGATCATGCAGCCACGC
GGCGCAGCGGTGTTGGCTTTTAAAAGAAAACAGAATCCCGAGAAGATGTTGCAGGAGGCGCGAGGTGGGAGACTT
CCACTCCTGGGCATCAGCGGCTTAAAGGATAAAGGATTGATTGCTGAGGAATTGAAAAGAGAGTTGGAAAACTTG
GGGTGGAAAAGGATGACCTATCGGTTTTTGCAAGACGCGGATCATATCCCTTGGGTGTCTTGTGCAGAAGAGTTT
AGAGAAATTGTATTGACGTGGATCAAGGAGTTAACGCCATAA
Gene >AgabiH97|085540
ATGTTCTCCATTTGGCCAAAGGGAGCTAAGTATACATACCTGACAAATCCGTGAAAATAAGCGATTATAGGTCTT
CATTCCGATCTCCGATCAGCTTGGTAATGTCAATGAACGACGGAACCTGAAACTAGTCTAAGGTGCAGTTGGGAA
CATAATAACTTGAGTGTTCATCGAACAGAGACTGAGCCCCTCTCAGGTTTTCATCCCTTGATTGTCATCCGAGCC
CCTTTGTTTTGGGGGATATATGTTGGCGATATTTTACCTTTGGCAGCACCCGGATACTCCTTCATGGCCGGAGAC
TTGGAAGTGAATACCTCTCGCTTAGTGAAGTCAGCTGATGGTACGGAAATATATACGGACGCGACAGGAAACCGC
TCGCCGAGCACCCCAGTCCTCGTTTTGGTCCATGGTCTTTTCATGAACAAAGGCGCATTCAATCCTATCTTCGAC
GATCCCAAATGGACCTCTAGTCTCTTCCTAGTAAGCCAAGCTGGCGGCATGGTGAACTTGACTGAATTGAAGCTC
GTGATATTGACAGGTGCGGTACGATACCCGTGGACATGGTAGAAGCGGAAAATCGGTTGCCGAGGAAGCCTGGGA
ATCCAAACGGTTTTCGGAAGATTTTGAAGCTGTTTGCAGAGAATTCGAAGTAAGAGAAGCATATGTCTTGGGATG
GAGTATGGGTGGTGGGCTGTTTCCTTTGCTCAATACCACTAGACGCAGCACTGATACCTTCTCAGCCGCTCTGTT
CCCTGATATTATGACCTACACCACTTCAGTCAAGATACTTGGCTTCATTAATGTCGCGGGAGTCGTATCCGTGGA
CCCCTCGATCAAACGAAGCTCATCTCGTCCATTGGCAAATGAATGGGGGGGTATACTCCTATCCCCTCCTTCCGT
AGATGCCTTCCAAGAAGCTTTATTTCAATTCCTCCATATATGCTCTGACGAGCTCTCTCCAGAGCTCTTCCGCAT
TTTACTGGAAGGAATGATCATGCAGCCACGCGGCGCAGCGGTGTTGGCTTTTAAAAGAAAACAGAATCCCGAGAA
GATGTTGCAGGAGGCGCGAGGTGGGAGACTTCCACTCCTGGGCATCAGCGGCTTAAAGGATAAAGGATTGATTGC
TGAGGAATTGAAAAGAGAGTTGGAAAACTTGGGGTGGAAAAGGATGACCTATCGGTTTTTGCAAGACGCGGATCA
TATCCCTTGGGTGTCTTGTGCAGAAGAGTTTAGAGAAATTGTATTGACGTGGATCAAGGAGTTAACGCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail