Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085460
Gene name
Locationscaffold_5:1813480..1815822
Strand+
Gene length (bp)2342
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.6E-19 104 478

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46996|YJQ3_YEAST Uncharacterized membrane protein YJL163C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL163C PE=1 SV=1 89 493 5.0E-17
sp|O13714|YDZ7_SCHPO Uncharacterized membrane protein C14C4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.07 PE=1 SV=1 84 503 4.0E-09
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 106 515 3.0E-06

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 37 56 19
2 102 121 19
3 131 150 19
4 163 185 22
5 200 222 22
6 229 251 22
7 276 298 22
8 314 336 22
9 351 373 22
10 495 517 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085460
MHPHHHTGHEEENSLIARDDVQHQPFRTTLPFVRYRAHTYWLLPVILVFSMSRGITSSPRIQVYKAIACRALMDN
STDFTSLADLPGCDSSDVQARAAKIQAGVITCMSVLSAISTGFWSRLGDAHGRKPILITFMSGALVMEAVFVLVM
RQNSFFGRHAEQLIYLGPAAEGFVGGLSTFNGVVHAYVADCTRHGSRSKVFSTIQGIVFVGLSLGPWFGGLFLPK
TGYSHSFFLCSIGLLICTILYVLFICPESKFPSETADNSPSDFQRLKHSPIQAMRHVSVKFITALLSPLFVFAPQ
RIRGTNKRSWNMTLVGLSFLIYCISIGVYSAKYLYAQHVYTWTTAQLGYYMSTLWISRALNLLLVLPIVIHYLKP
KRSSPGNQPSPSDVAAELVFDKYLAQISLLVDGLADALVAAISNKSQATFVVLSCLSSFTSGGNPALQSLAAVCL
HALGHSDEAGTLFGALGVLNSVAHIISPTLYATTYGATVASFPQAIFVLAACLLFTIVALLLGVWPASVIPNSTA
LSDPETNPLSGDFSDPTDHSEDFLPSDSIDRESGTDYKYNGIGTSPPRTNSGGFEGSHHS*
Coding >AgabiH97|085460
ATGCATCCCCACCACCACACAGGCCATGAGGAGGAGAACTCCCTCATCGCCAGAGACGATGTCCAGCACCAGCCA
TTTCGTACTACGCTTCCCTTTGTGCGCTACAGAGCACACACCTACTGGCTCCTCCCCGTCATCCTCGTGTTTTCC
ATGTCTCGCGGTATCACGTCCTCACCCAGAATACAAGTCTACAAGGCCATTGCATGTCGCGCGCTCATGGACAAC
TCGACTGATTTCACAAGCCTCGCTGACTTACCAGGGTGCGACAGCTCCGATGTCCAAGCCCGGGCAGCAAAGATA
CAAGCTGGTGTCATTACCTGCATGAGCGTTCTCAGTGCTATCTCAACCGGTTTCTGGAGCCGACTGGGGGATGCT
CATGGCAGGAAACCTATCCTTATCACCTTCATGTCTGGTGCACTCGTCATGGAAGCTGTCTTTGTGCTCGTTATG
CGCCAGAACTCATTTTTTGGTCGTCATGCCGAACAGCTCATATATCTAGGGCCGGCTGCTGAAGGCTTTGTTGGT
GGCTTATCAACTTTTAATGGTGTCGTTCATGCTTACGTCGCGGACTGCACTAGGCATGGATCCAGGTCAAAAGTC
TTCTCCACTATACAAGGCATCGTATTTGTTGGCCTTTCCCTTGGCCCTTGGTTTGGTGGCCTCTTCCTACCAAAG
ACCGGATACAGCCATTCTTTTTTTCTCTGCAGCATTGGCCTTCTAATATGCACCATTCTATATGTGCTTTTCATT
TGCCCAGAGTCCAAGTTCCCCTCGGAAACTGCGGACAACTCTCCGAGTGACTTCCAACGACTCAAACATTCTCCT
ATTCAGGCTATGCGCCATGTCTCAGTGAAGTTTATTACCGCCCTTCTGTCGCCCTTGTTCGTGTTTGCACCCCAA
CGTATCCGAGGAACGAATAAGAGAAGTTGGAATATGACCTTGGTCGGACTCAGCTTTTTAATCTACTGTATATCA
ATTGGCGTATATTCAGCCAAATACCTCTATGCTCAACATGTCTATACATGGACAACAGCTCAGCTTGGATACTAT
ATGTCGACGCTATGGATATCCAGAGCACTCAACCTCTTATTGGTCCTTCCAATCGTCATTCATTATCTTAAACCA
AAGCGTTCATCTCCCGGAAATCAACCGTCTCCTTCCGACGTCGCTGCAGAATTGGTATTTGATAAGTACCTGGCC
CAGATATCCTTATTAGTGGACGGGTTAGCAGACGCCCTCGTCGCCGCCATCTCTAATAAATCGCAAGCAACGTTT
GTCGTTCTCTCATGCCTATCATCTTTCACCAGTGGAGGCAACCCGGCTCTACAGTCCCTTGCCGCAGTATGTCTA
CATGCACTTGGCCATTCTGATGAAGCTGGTACATTGTTTGGTGCGTTGGGAGTATTAAATTCAGTGGCGCATATC
ATTTCTCCAACCTTGTATGCGACAACATACGGAGCTACAGTTGCTTCTTTCCCACAAGCTATCTTTGTTTTGGCG
GCCTGCCTTCTGTTCACGATTGTCGCACTCTTGCTTGGAGTGTGGCCGGCATCAGTCATCCCAAATTCTACCGCC
CTTTCTGATCCAGAAACTAATCCGCTAAGTGGAGACTTTTCCGACCCTACAGATCATTCCGAAGATTTCCTACCT
TCGGACAGTATAGACAGGGAATCAGGGACTGATTACAAGTATAATGGCATTGGAACATCGCCGCCAAGAACTAAT
TCTGGGGGTTTTGAAGGTTCACATCACTCGTAA
Transcript >AgabiH97|085460
ATGCATCCCCACCACCACACAGGCCATGAGGAGGAGAACTCCCTCATCGCCAGAGACGATGTCCAGCACCAGCCA
TTTCGTACTACGCTTCCCTTTGTGCGCTACAGAGCACACACCTACTGGCTCCTCCCCGTCATCCTCGTGTTTTCC
ATGTCTCGCGGTATCACGTCCTCACCCAGAATACAAGTCTACAAGGCCATTGCATGTCGCGCGCTCATGGACAAC
TCGACTGATTTCACAAGCCTCGCTGACTTACCAGGGTGCGACAGCTCCGATGTCCAAGCCCGGGCAGCAAAGATA
CAAGCTGGTGTCATTACCTGCATGAGCGTTCTCAGTGCTATCTCAACCGGTTTCTGGAGCCGACTGGGGGATGCT
CATGGCAGGAAACCTATCCTTATCACCTTCATGTCTGGTGCACTCGTCATGGAAGCTGTCTTTGTGCTCGTTATG
CGCCAGAACTCATTTTTTGGTCGTCATGCCGAACAGCTCATATATCTAGGGCCGGCTGCTGAAGGCTTTGTTGGT
GGCTTATCAACTTTTAATGGTGTCGTTCATGCTTACGTCGCGGACTGCACTAGGCATGGATCCAGGTCAAAAGTC
TTCTCCACTATACAAGGCATCGTATTTGTTGGCCTTTCCCTTGGCCCTTGGTTTGGTGGCCTCTTCCTACCAAAG
ACCGGATACAGCCATTCTTTTTTTCTCTGCAGCATTGGCCTTCTAATATGCACCATTCTATATGTGCTTTTCATT
TGCCCAGAGTCCAAGTTCCCCTCGGAAACTGCGGACAACTCTCCGAGTGACTTCCAACGACTCAAACATTCTCCT
ATTCAGGCTATGCGCCATGTCTCAGTGAAGTTTATTACCGCCCTTCTGTCGCCCTTGTTCGTGTTTGCACCCCAA
CGTATCCGAGGAACGAATAAGAGAAGTTGGAATATGACCTTGGTCGGACTCAGCTTTTTAATCTACTGTATATCA
ATTGGCGTATATTCAGCCAAATACCTCTATGCTCAACATGTCTATACATGGACAACAGCTCAGCTTGGATACTAT
ATGTCGACGCTATGGATATCCAGAGCACTCAACCTCTTATTGGTCCTTCCAATCGTCATTCATTATCTTAAACCA
AAGCGTTCATCTCCCGGAAATCAACCGTCTCCTTCCGACGTCGCTGCAGAATTGGTATTTGATAAGTACCTGGCC
CAGATATCCTTATTAGTGGACGGGTTAGCAGACGCCCTCGTCGCCGCCATCTCTAATAAATCGCAAGCAACGTTT
GTCGTTCTCTCATGCCTATCATCTTTCACCAGTGGAGGCAACCCGGCTCTACAGTCCCTTGCCGCAGTATGTCTA
CATGCACTTGGCCATTCTGATGAAGCTGGTACATTGTTTGGTGCGTTGGGAGTATTAAATTCAGTGGCGCATATC
ATTTCTCCAACCTTGTATGCGACAACATACGGAGCTACAGTTGCTTCTTTCCCACAAGCTATCTTTGTTTTGGCG
GCCTGCCTTCTGTTCACGATTGTCGCACTCTTGCTTGGAGTGTGGCCGGCATCAGTCATCCCAAATTCTACCGCC
CTTTCTGATCCAGAAACTAATCCGCTAAGTGGAGACTTTTCCGACCCTACAGATCATTCCGAAGATTTCCTACCT
TCGGACAGTATAGACAGGGAATCAGGGACTGATTACAAGTATAATGGCATTGGAACATCGCCGCCAAGAACTAAT
TCTGGGGGTTTTGAAGGTTCACATCACTCGTAA
Gene >AgabiH97|085460
ATGCATCCCCACCACCACACAGGCCATGAGGAGGAGAACTCCCTCATCGCCAGAGACGATGTCCAGCACCAGCCA
TTTCGTACTACGCTTCCCTTTGTGCGCTACAGAGCACACACCTACTGGTAAATACTCCCAGTTCCCTGTCTGCCC
GCTTCCGCTCACCCTGGCACCCCAGGCTCCTCCCCGTCATCCTCGTGTTTTCCATGTCTGCAAGTAAAAATCATC
TACCCCTCGCTCCATGTGCTCATATTGTGACTCGTAGCGCGGTATCACGTCCTCACCCAGAATACAAGTCTACAA
GGCCATTGCATGTCGCGCGCTCATGGACAACTCGACTGATTTCACAAGCCTCGCTGACTTACCAGGGTGCGACAG
CTCCGATGTCCAAGCCCGGGCAGCAAAGATACAAGCTGGTAGGTCGCGCTTTTCTTTTGCCAAATGTCATCTAAA
TAATCATAGGTGTCATTACCTGCATGAGCGTTCTCAGTGCTATCTCAACCGGTTTCTGGAGCCGACTGGGGGATG
CTCATGGCAGGAAACCTATCCTTATCACCTTCATGTCTGGTGCACTCGTCATGTGCGTTCCCCCATTGCCTTCTG
CTTGACTACATCTCATATTCTTTCACAGGGAAGCTGTCTTTGTGCTCGTTATGCGCCAGAACTCATTTTTTGGTC
GTCATGCCGAACAGCTCATATATCTAGGGCCGGCTGCTGAAGGCTTTGTTGGTGGCTTATCAACTTTTAATGGTG
TCGTTCATGCGTCAGCGTCCACCTTTTTTCTCTGTTGCCCCATCATCTGAATTGTTTCAAAGTTACGTCGCGGAC
TGCACTAGGCATGGATCCAGGTGAGTAGCGAGTCAACCATTTATTCTGTATACCGACCGTACTAGGTCAAAAGTC
TTCTCCACTATACAAGGCATCGTATTTGTTGGCCTTTCCCTTGGCCCTTGGGTAGGTCGCCCCAATATCACTAAT
CTGGAAAATATGCTCACGTCTCTTAGTTTGGTGGCCTCTTCCTACCAAAGACCGGATACAGCCATTCTTTTTTTC
TCTGCAGCATTGGCCTTCTAATATGCACCATTCTATATGTGCTTTTCATTTGCCCAGAGTCCAAGTTCCCCTCGG
AAACTGCGGACAACTCTCCGAGTGACTTCCAACGACTCAAACATTCTCCTATTCAGGCTATGCGCCATGTCTCAG
TGAAGTTTATTACCGCCCTTCTGTCGCCCTTGTTCGTGTTTGCACCCCAACGTATCCGAGGAACGAATAAGAGAA
GTTGGAATATGACCTTGGTCGGACTCAGCTTTTTAATCTACTGTATATCAATTGTGAGTAATACTGTCCACGGTT
ATCTTCCATTCTTCTCTCTGATAGCTATCAGGGCGTATATTCAGCCAAATACCTCTATGCTCAACATGTCTATAC
ATGGACAACAGCTCAGGTGAAGCAGAAACATTGCAATACAATCTATTGATGGACTGTTGCTGACGATTGTCCGAT
AGCTTGGATACTATATGTCGACGCTATGGATATCCAGAGCACTCAACCTCTTATTGGTCCTTCCAAGCAAGTAAC
CTCCTTTTGTCTCCTGTTCCTACGCTAACCAGCTGCATAGTCGTCATTCATTATCTTAAACCAAAGCGTTCATCT
CCCGGAAATCAACCGTCTCCTTCCGACGTCGCTGCAGAATTGGTATTTGATAAGTACCTGGCCCAGATATCCTTA
TTAGTGGACGGGTTAGCAGACGCCCTCGTCGCCGCCATCTCTAATAAATCGCAAGCAACGTTTGTCGTTCTCTCA
TGCCTATCATCTTTCACCAGTGGAGGCAACCCGGCTCTACAGTCCCTTGCCGCAGTATGTCTACATGCACTTGGC
CATTCTGATGAAGCTGGTACATTGTTTGGTGCGTTGGGAGTATTAAATTCAGTGGCGCATATCATTTCTGTCAGT
CAAATTTTGCCGTCTATCTAATTCTTGATGATCTTTCGGCTGACGCTTCTCCTATCGTATCACAGCCAACCTTGT
ATGCGACAACATACGGAGCTACAGTTGCTTCTTTCCCACAAGCTATCTTTGTTTTGGCGGCCTGCCTTCTGTTCA
CGATTGTCGCACTCTTGCTTGGAGTGTGGCCGGCATCAGTCATCCCAAATTCTACCGCCCTTTCTGATCCAGAAA
CTAATCCGCTAAGTGGAGACTTTTCCGACCCTACAGATCATTCCGAAGATTTCCTACCTTCGGACAGTATAGACA
GGGAATCAGGGACTGATTACAAGTATAATGGCATTGGAACATCGCCGCCAAGAACTAATTCTGGGGGTTTTGAAG
GTTCACATCACTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail