Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085380
Gene name
Locationscaffold_5:1791783..1793112
Strand-
Gene length (bp)1329
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.6E-07 18 114
PF02263 GBP Guanylate-binding protein, N-terminal domain 2.3E-05 15 88

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085380
MAKRINATRDVRKDDTIIAFMGPTGAGKSFFIDLLTGASDQDRRAGSTLRSVTSQIEATTVVHPSDKDRRVVLVD
TPGFDDTTRSDMQILQMISEWLQSMYKADVKLSGLIYLHRITDNRMAGSPYKNLRMFGELCGDVAMNQVFLVSTM
WGKIKPEIGEAREQELKDRFWEPLIKKGSSVERLSKTKSDEAWRIVNKLIEIHDKKLKKEIVLLQEEMVDLGIKL
NETQAGKTLYTSLQKQLVDQKDALKSLLTQVEKSNDRELTKELKKEYDKIEADFQKTFEEAKKFKVSIGTKIVGI
FGGKKAKAKANKTSAICGSSFRRSKQ*
Coding >AgabiH97|085380
ATGGCGAAACGTATTAATGCTACGAGAGATGTCCGAAAAGACGACACCATCATTGCCTTCATGGGTCCCACTGGA
GCTGGCAAGAGCTTTTTTATTGACCTCCTTACGGGCGCCAGTGATCAAGACCGACGAGCTGGCAGCACTTTGAGA
TCGGTTACTAGCCAGATAGAGGCCACGACCGTCGTTCACCCTTCCGATAAGGATAGACGTGTTGTCCTCGTGGAT
ACACCTGGATTCGACGATACCACTAGATCCGACATGCAAATACTACAAATGATCAGCGAATGGCTCCAAAGCATG
TATAAGGCAGACGTGAAATTGAGTGGGCTTATATACCTTCACCGTATCACCGACAATCGTATGGCAGGTTCGCCA
TACAAGAACCTCCGCATGTTTGGCGAATTATGTGGAGATGTCGCCATGAACCAAGTGTTTTTAGTATCGACTATG
TGGGGAAAAATCAAACCAGAAATCGGAGAGGCCAGAGAACAGGAACTTAAAGACAGATTCTGGGAGCCGCTGATC
AAGAAAGGATCCAGTGTCGAACGTTTATCCAAGACCAAAAGTGACGAAGCCTGGCGCATCGTCAATAAGCTAATT
GAAATCCACGATAAGAAGTTGAAAAAGGAGATAGTACTGTTGCAGGAGGAAATGGTCGACCTTGGAATCAAACTC
AACGAAACCCAAGCAGGAAAGACCCTATATACTTCGCTCCAAAAACAGCTTGTGGACCAGAAAGATGCTTTGAAA
TCATTACTCACCCAGGTGGAGAAGTCGAATGATAGAGAATTGACGAAGGAATTGAAGAAGGAATACGATAAAATT
GAGGCTGACTTTCAGAAGACGTTCGAGGAGGCGAAAAAGTTCAAGGTATCCATTGGAACCAAGATTGTAGGGATA
TTTGGAGGAAAGAAAGCGAAAGCTAAAGCCAATAAGACATCAGCTATCTGCGGAAGCTCGTTTCGACGGAGCAAA
CAATGA
Transcript >AgabiH97|085380
ATGGCGAAACGTATTAATGCTACGAGAGATGTCCGAAAAGACGACACCATCATTGCCTTCATGGGTCCCACTGGA
GCTGGCAAGAGCTTTTTTATTGACCTCCTTACGGGCGCCAGTGATCAAGACCGACGAGCTGGCAGCACTTTGAGA
TCGGTTACTAGCCAGATAGAGGCCACGACCGTCGTTCACCCTTCCGATAAGGATAGACGTGTTGTCCTCGTGGAT
ACACCTGGATTCGACGATACCACTAGATCCGACATGCAAATACTACAAATGATCAGCGAATGGCTCCAAAGCATG
TATAAGGCAGACGTGAAATTGAGTGGGCTTATATACCTTCACCGTATCACCGACAATCGTATGGCAGGTTCGCCA
TACAAGAACCTCCGCATGTTTGGCGAATTATGTGGAGATGTCGCCATGAACCAAGTGTTTTTAGTATCGACTATG
TGGGGAAAAATCAAACCAGAAATCGGAGAGGCCAGAGAACAGGAACTTAAAGACAGATTCTGGGAGCCGCTGATC
AAGAAAGGATCCAGTGTCGAACGTTTATCCAAGACCAAAAGTGACGAAGCCTGGCGCATCGTCAATAAGCTAATT
GAAATCCACGATAAGAAGTTGAAAAAGGAGATAGTACTGTTGCAGGAGGAAATGGTCGACCTTGGAATCAAACTC
AACGAAACCCAAGCAGGAAAGACCCTATATACTTCGCTCCAAAAACAGCTTGTGGACCAGAAAGATGCTTTGAAA
TCATTACTCACCCAGGTGGAGAAGTCGAATGATAGAGAATTGACGAAGGAATTGAAGAAGGAATACGATAAAATT
GAGGCTGACTTTCAGAAGACGTTCGAGGAGGCGAAAAAGTTCAAGGTATCCATTGGAACCAAGATTGTAGGGATA
TTTGGAGGAAAGAAAGCGAAAGCTAAAGCCAATAAGACATCAGCTATCTGCGGAAGCTCGTTTCGACGGAGCAAA
CAATGA
Gene >AgabiH97|085380
ATGGCGAAACGTATTAATGCTACGAGAGATGTCCGAAAAGACGACACCATCATTGCGTAAGTGAAGTTTTCTCCA
AGAACGACCCCCTTGAAAGTCCGGACTTAATGTAATGACACAGCTTCATGGGTCCCACTGGAGCTGGCAAGAGCT
TTGTGGGTAGATTTTATCACGACGACTAATACTAAACTCACCGTCATGATGATATTTGTTTTTTTCTTTCTCAAG
TTTATTGACCTCCTTACGGGCGCCAGTGATCAAGACCGACGAGCTGGCAGCACTTTGAGATCGGTTACTAGCCAG
ATAGAGGCCACGACCGTCGTTCACCCTTCCGATAAGGATAGACGTGTTGTCCTCGTGGATACACCTGGATTCGAC
GATACCACTAGATCCGACATGCAAATACTACAAATGATCAGCGAATGGCTCCAAAGCATGTAAGTTTCATATCTT
ACTTATGGCTTTGCAAAGGGTCAACTGAAAGATATGTGCGGTTAGGTATAAGGCAGACGTGAAATTGAGTGGGCT
TATATACCTTCACCGTATCACCGACAATCGTATGGCAGGTTCGCCATACAAGAACCTCCGCATGTTTGGCGAATT
ATGTGGAGATGTCGCCATGAACCAAGTGTTTTTAGTATCGACTATGTGGGGAAAAATCAAACCAGAAATCGGAGA
GGCCAGAGAACAGGAACTTAAAGACAGATTCTGGGAGCCGCTGATCAAGAAAGGATCCAGTGTCGAACGTTTATC
CAAGACCAAAAGTGACGAAGCCTGGCGCATCGTCAATAAGCTAATTGAAATCCACGATAAGAAGTTGAAAAAGGA
GATAGTACTGTTGCAGGAGGAAATGGTCGACCTTGGAATCAAACTCAACGAAACCCAAGCAGGAAAGACCCTATA
TACTTCGCTCCAAAAACAGCTTGTGGACCAGAAAGATGCTTTGAAATCATTACTCACCCAGGTGGAGAAGTCGAA
TGATAGAGAATTGACGAAGGAATTGAAGAAGGAATACGATAAAATTGAGGCTGACTTTCAGAAGACGTTCGAGGA
GGCGAAAAAGTTCAAGGTATCCATTGGAACCAAGATTGTAGGGATATTTGGAGGAAAGAAAGCGAAAGCTGTAAG
TACAATTCCTCGAAACGGCAGCCATTCACTAACACCATTACAGAAAGCCGTCAAGATTGGAGACGCGTAACTGCG
TAGCATCCCGGTGAAAACAGAATAAGACATCAGGTATGATGGTCGTTGACGTATTATAAATAGTCTTGCCGGCTG
ATGTATTAAGCTACAGCTATCTGCGGAAGCTCGTTTCGACGGAGCAAACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail