Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085370
Gene name
Locationscaffold_5:1785702..1790315
Strand+
Gene length (bp)4613
Transcript length (bp)3600
Coding sequence length (bp)3600
Protein length (aa) 1200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-17 194 492

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13714|YDZ7_SCHPO Uncharacterized membrane protein C14C4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.07 PE=1 SV=1 170 495 6.0E-09

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 192 214 22
2 221 243 22
3 258 280 22
4 293 315 22
5 330 352 22
6 395 416 21
7 431 450 19
8 471 493 22
9 594 616 22
10 658 680 22
11 695 717 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085370
MRPSLAIYTNFTLGVISLSHRALFVPNPTPYYQLHRHLPRNPTRIRRPKKPFHRARPLWIVPFALVVSVVRGMTL
APRVEVFTQLSCHRVYGLHSHPAAPSTPFPHLMTNISSLNSPVLKITNPVSVLEFASHAPESQPFLQLSIADGGS
IFDSGSNDEDTIEPGDETGDPRSIPSNRCVKDPRVQAGAAKLQMIMTTSMGLLSALTTGAWGHFGERHGRTSVLA
ISTLGLFLTDLAFILASTPGSVFSKHGHKFLLVAPVIEGALGGWSTVQASTSAYISDCTSSGSRAQVFSRFTGVT
YLGVLLGPTISGYQISRSGASGVGGNKNVTSVFWVAVCCSFLNFLAAVFVFPESLSEEKRRKARAEYDANGKGKT
PTGDGVVAEGRRRTSLFRKLFGPIITAPVQILSVLAVFLPVKVKSGGQLGSYRRDLSLTALGVAYFSYMLTLGLY
QLKYLYAEHMYGWGAEQLSWYISYLGGVRAIALLVILPFLIGILKPKAVDSDKGKDKSNVTPVIAAATPDGGKRK
PTRSQLGREIAFDLSLVRCSLLMDVVSDLLVVVSPAPILHETSIGKQILNQASHANRGAVSLKSSQTLFVLATGF
ASFGTGAAPAIHSLALCILQARETVLQPTMRDGDEETTDVEMSAEPEASTAAQGGNVGGVFGAFAFLQAIGSMIL
GPLLFGMVYSSTVAGMPKAIFMVAVASLSVALVLLMLVRNPVGKDGDTKGQKRAGDVARGRSRASKDLRGGAAGL
TYCIFLDQTRTNRVRAFLGCYHFLSPGADMNNSNALAGPSSPRTDHPPLFLPPPGPPPPRQNLASTQDLLSRFHL
LSAYDRYVRPCATQYVQDGQLRSTPTPSSTLDKGKGKEVDTGNPLPQAQNSNPPGAASTGATDADEDDAAGGKGE
KRKKSNYKALIKGIPGKHSMKKDDYLTSMMMIPPKQPTRIHQFDVRTQQEAFAVSPEGLKGWNVMTLILESAQAR
EDRKKRKELKRLAKAQQAHAALQAGAAASPTVAQPQPLRAAAGSMPQKSASATPQVQQSPSSMPKSTGTPRPVST
APRPGSTVPRPGSAVSKLGSTMRPTSAASPNIKQEQKMHTLPVQIPGPPAMVTTSRTATATPDLHRGKKRDRDDG
MLSNVTINGTSATDTHVNGTTLNGIGNGNGLSKLNAKAGSGGVRPRPSKKQRVDVQGQAREVSAPVQQPTPQGV*
Coding >AgabiH97|085370
ATGCGTCCTAGTCTCGCTATTTATACGAACTTTACCTTGGGGGTGATTTCACTGAGTCACCGCGCCCTCTTCGTC
CCTAACCCTACCCCTTATTATCAACTACACAGACACCTACCGCGGAATCCGACTAGAATAAGAAGACCGAAGAAA
CCGTTTCATAGAGCTAGGCCATTATGGATTGTACCTTTTGCACTGGTTGTTTCCGTCGTTCGGGGAATGACGCTC
GCGCCTCGAGTGGAGGTGTTCACGCAACTTTCGTGTCATCGAGTGTATGGTCTCCACAGTCATCCCGCCGCACCA
TCCACGCCCTTTCCCCATTTGATGACTAATATTTCCTCCTTAAACTCTCCTGTTCTTAAAATAACAAATCCGGTA
TCGGTCCTAGAGTTTGCCTCGCACGCCCCCGAATCACAGCCATTTTTGCAATTGAGCATCGCAGACGGAGGCAGT
ATATTTGATTCAGGTAGTAACGATGAAGACACCATTGAACCAGGCGACGAAACTGGTGATCCTCGAAGTATACCG
TCGAATCGATGTGTCAAAGACCCAAGGGTTCAAGCTGGAGCAGCCAAATTGCAAATGATCATGACTACGAGCATG
GGACTGCTCTCCGCATTAACCACGGGGGCATGGGGACATTTTGGTGAACGCCATGGGCGTACAAGTGTACTTGCT
ATATCAACTCTGGGATTGTTCCTGACTGATCTGGCCTTCATCCTTGCTTCGACCCCGGGTTCAGTTTTTTCGAAG
CATGGACACAAGTTTCTCCTCGTGGCACCTGTGATTGAAGGTGCCCTCGGTGGTTGGTCGACAGTGCAAGCATCC
ACATCAGCATATATATCAGATTGCACCTCCAGTGGCTCCAGGGCGCAAGTGTTTTCTCGATTCACGGGCGTTACT
TACTTGGGCGTCCTCCTTGGGCCTACTATCAGTGGATACCAGATTTCACGTTCTGGTGCCAGTGGCGTCGGGGGA
AACAAAAACGTCACTAGCGTGTTTTGGGTGGCGGTGTGTTGTTCATTCCTAAACTTCTTGGCTGCTGTTTTTGTT
TTTCCCGAGTCACTGTCAGAGGAGAAAAGGAGGAAAGCAAGAGCAGAATATGATGCCAATGGGAAAGGGAAAACG
CCCACTGGTGATGGTGTGGTAGCAGAGGGGAGACGAAGAACGAGCCTTTTTAGGAAGTTGTTTGGACCAATTATA
ACAGCACCGGTCCAAATCCTATCGGTGTTAGCAGTGTTTCTGCCAGTGAAAGTGAAGTCGGGTGGTCAATTGGGA
TCGTATCGGCGAGATTTGAGCCTCACGGCGCTTGGAGTGGCATATTTTTCTTACATGTTGACACTGGGATTATAT
CAACTAAAGTATCTGTATGCTGAACATATGTATGGATGGGGGGCTGAACAGTTGAGCTGGTACATCTCATACCTC
GGTGGAGTGAGGGCGATAGCATTGTTGGTTATACTTCCTTTCCTTATCGGAATACTCAAACCCAAAGCGGTCGAC
TCGGATAAAGGGAAGGACAAAAGCAACGTCACGCCTGTAATAGCAGCAGCAACGCCGGATGGAGGGAAAAGAAAG
CCAACGCGAAGTCAACTTGGCCGCGAAATTGCGTTCGATTTGTCCCTTGTGCGATGTTCCCTCTTGATGGACGTG
GTCTCTGATCTGCTCGTCGTCGTATCACCAGCGCCGATACTTCATGAAACGTCTATCGGAAAGCAGATTTTAAAC
CAAGCTAGCCACGCAAATAGAGGAGCTGTCTCATTGAAATCAAGCCAGACTTTGTTTGTTCTTGCGACCGGGTTT
GCTAGTTTTGGAACAGGCGCGGCACCAGCGATTCATAGTTTGGCGTTGTGTATCCTGCAGGCCAGGGAGACAGTC
TTGCAGCCGACGATGAGGGATGGAGACGAGGAGACGACTGACGTCGAAATGTCGGCGGAACCAGAAGCCAGCACG
GCTGCCCAGGGTGGAAATGTGGGTGGTGTGTTTGGTGCGTTTGCGTTTTTGCAGGCGATTGGATCAATGATCCTT
GGGCCGTTGCTCTTTGGGATGGTTTACAGCAGCACGGTGGCCGGGATGCCCAAGGCTATCTTTATGGTGGCGGTT
GCATCGCTCTCTGTGGCGTTGGTGCTGCTGATGTTGGTGAGAAATCCGGTTGGGAAGGACGGGGACACGAAGGGC
CAGAAGAGAGCCGGGGACGTTGCACGGGGGAGATCGCGGGCGAGCAAGGACCTGCGAGGGGGTGCTGCCGGTTTA
ACATATTGTATTTTCCTAGACCAAACAAGGACAAACAGAGTGAGGGCGTTTCTCGGTTGTTATCACTTTCTCTCT
CCCGGCGCTGACATGAACAACTCGAATGCGCTAGCTGGCCCCTCGTCGCCGCGCACAGACCACCCGCCCCTCTTC
CTCCCACCGCCAGGCCCGCCGCCACCAAGACAGAACCTCGCGAGCACCCAGGACCTTCTCTCCCGCTTCCATCTC
CTCTCTGCCTACGACAGATATGTTCGCCCATGTGCTACCCAATACGTCCAGGATGGCCAGTTACGCTCGACTCCC
ACACCTTCCTCGACGCTTGACAAGGGAAAGGGAAAAGAAGTTGACACCGGCAACCCCTTACCACAAGCACAGAAC
TCCAATCCTCCAGGCGCCGCCAGCACCGGAGCTACAGATGCTGACGAGGATGATGCGGCAGGCGGGAAAGGCGAA
AAAAGGAAGAAGAGTAATTACAAGGCTCTCATCAAGGGCATTCCAGGAAAACATTCGATGAAAAAGGACGATTAC
TTGACAAGCATGATGATGATCCCACCGAAGCAACCTACGCGTATCCATCAATTTGACGTCAGGACACAGCAAGAG
GCCTTCGCAGTGAGTCCAGAAGGTTTGAAAGGCTGGAATGTCATGACTTTGATCTTGGAGTCTGCCCAAGCTCGA
GAGGATCGGAAGAAGCGGAAGGAGCTCAAGCGCCTAGCAAAAGCTCAACAGGCACACGCAGCGTTACAGGCTGGT
GCAGCAGCGTCACCTACAGTTGCTCAACCACAACCTCTACGGGCAGCTGCAGGCTCCATGCCACAGAAAAGCGCG
TCTGCTACGCCACAGGTCCAGCAATCACCTTCGTCAATGCCAAAATCAACTGGAACACCAAGACCGGTATCAACT
GCCCCACGCCCAGGATCTACGGTACCACGACCCGGTTCCGCTGTTTCCAAACTCGGTTCTACCATGCGTCCGACT
TCCGCGGCATCACCGAACATTAAACAGGAACAGAAGATGCATACGCTTCCAGTCCAGATTCCTGGGCCACCGGCC
ATGGTCACAACCTCAAGGACAGCGACAGCGACCCCTGATCTGCACAGAGGGAAGAAGAGAGACAGGGACGATGGA
ATGTTATCGAATGTCACGATAAATGGGACTTCTGCGACGGATACTCATGTGAATGGGACGACCCTTAATGGCATT
GGGAATGGAAATGGGTTATCGAAGCTTAATGCCAAGGCGGGCTCTGGTGGTGTGCGACCTAGACCATCTAAAAAG
CAGCGTGTGGACGTGCAAGGGCAGGCAAGGGAAGTCAGCGCTCCCGTCCAACAACCTACACCTCAAGGTGTATAA
Transcript >AgabiH97|085370
ATGCGTCCTAGTCTCGCTATTTATACGAACTTTACCTTGGGGGTGATTTCACTGAGTCACCGCGCCCTCTTCGTC
CCTAACCCTACCCCTTATTATCAACTACACAGACACCTACCGCGGAATCCGACTAGAATAAGAAGACCGAAGAAA
CCGTTTCATAGAGCTAGGCCATTATGGATTGTACCTTTTGCACTGGTTGTTTCCGTCGTTCGGGGAATGACGCTC
GCGCCTCGAGTGGAGGTGTTCACGCAACTTTCGTGTCATCGAGTGTATGGTCTCCACAGTCATCCCGCCGCACCA
TCCACGCCCTTTCCCCATTTGATGACTAATATTTCCTCCTTAAACTCTCCTGTTCTTAAAATAACAAATCCGGTA
TCGGTCCTAGAGTTTGCCTCGCACGCCCCCGAATCACAGCCATTTTTGCAATTGAGCATCGCAGACGGAGGCAGT
ATATTTGATTCAGGTAGTAACGATGAAGACACCATTGAACCAGGCGACGAAACTGGTGATCCTCGAAGTATACCG
TCGAATCGATGTGTCAAAGACCCAAGGGTTCAAGCTGGAGCAGCCAAATTGCAAATGATCATGACTACGAGCATG
GGACTGCTCTCCGCATTAACCACGGGGGCATGGGGACATTTTGGTGAACGCCATGGGCGTACAAGTGTACTTGCT
ATATCAACTCTGGGATTGTTCCTGACTGATCTGGCCTTCATCCTTGCTTCGACCCCGGGTTCAGTTTTTTCGAAG
CATGGACACAAGTTTCTCCTCGTGGCACCTGTGATTGAAGGTGCCCTCGGTGGTTGGTCGACAGTGCAAGCATCC
ACATCAGCATATATATCAGATTGCACCTCCAGTGGCTCCAGGGCGCAAGTGTTTTCTCGATTCACGGGCGTTACT
TACTTGGGCGTCCTCCTTGGGCCTACTATCAGTGGATACCAGATTTCACGTTCTGGTGCCAGTGGCGTCGGGGGA
AACAAAAACGTCACTAGCGTGTTTTGGGTGGCGGTGTGTTGTTCATTCCTAAACTTCTTGGCTGCTGTTTTTGTT
TTTCCCGAGTCACTGTCAGAGGAGAAAAGGAGGAAAGCAAGAGCAGAATATGATGCCAATGGGAAAGGGAAAACG
CCCACTGGTGATGGTGTGGTAGCAGAGGGGAGACGAAGAACGAGCCTTTTTAGGAAGTTGTTTGGACCAATTATA
ACAGCACCGGTCCAAATCCTATCGGTGTTAGCAGTGTTTCTGCCAGTGAAAGTGAAGTCGGGTGGTCAATTGGGA
TCGTATCGGCGAGATTTGAGCCTCACGGCGCTTGGAGTGGCATATTTTTCTTACATGTTGACACTGGGATTATAT
CAACTAAAGTATCTGTATGCTGAACATATGTATGGATGGGGGGCTGAACAGTTGAGCTGGTACATCTCATACCTC
GGTGGAGTGAGGGCGATAGCATTGTTGGTTATACTTCCTTTCCTTATCGGAATACTCAAACCCAAAGCGGTCGAC
TCGGATAAAGGGAAGGACAAAAGCAACGTCACGCCTGTAATAGCAGCAGCAACGCCGGATGGAGGGAAAAGAAAG
CCAACGCGAAGTCAACTTGGCCGCGAAATTGCGTTCGATTTGTCCCTTGTGCGATGTTCCCTCTTGATGGACGTG
GTCTCTGATCTGCTCGTCGTCGTATCACCAGCGCCGATACTTCATGAAACGTCTATCGGAAAGCAGATTTTAAAC
CAAGCTAGCCACGCAAATAGAGGAGCTGTCTCATTGAAATCAAGCCAGACTTTGTTTGTTCTTGCGACCGGGTTT
GCTAGTTTTGGAACAGGCGCGGCACCAGCGATTCATAGTTTGGCGTTGTGTATCCTGCAGGCCAGGGAGACAGTC
TTGCAGCCGACGATGAGGGATGGAGACGAGGAGACGACTGACGTCGAAATGTCGGCGGAACCAGAAGCCAGCACG
GCTGCCCAGGGTGGAAATGTGGGTGGTGTGTTTGGTGCGTTTGCGTTTTTGCAGGCGATTGGATCAATGATCCTT
GGGCCGTTGCTCTTTGGGATGGTTTACAGCAGCACGGTGGCCGGGATGCCCAAGGCTATCTTTATGGTGGCGGTT
GCATCGCTCTCTGTGGCGTTGGTGCTGCTGATGTTGGTGAGAAATCCGGTTGGGAAGGACGGGGACACGAAGGGC
CAGAAGAGAGCCGGGGACGTTGCACGGGGGAGATCGCGGGCGAGCAAGGACCTGCGAGGGGGTGCTGCCGGTTTA
ACATATTGTATTTTCCTAGACCAAACAAGGACAAACAGAGTGAGGGCGTTTCTCGGTTGTTATCACTTTCTCTCT
CCCGGCGCTGACATGAACAACTCGAATGCGCTAGCTGGCCCCTCGTCGCCGCGCACAGACCACCCGCCCCTCTTC
CTCCCACCGCCAGGCCCGCCGCCACCAAGACAGAACCTCGCGAGCACCCAGGACCTTCTCTCCCGCTTCCATCTC
CTCTCTGCCTACGACAGATATGTTCGCCCATGTGCTACCCAATACGTCCAGGATGGCCAGTTACGCTCGACTCCC
ACACCTTCCTCGACGCTTGACAAGGGAAAGGGAAAAGAAGTTGACACCGGCAACCCCTTACCACAAGCACAGAAC
TCCAATCCTCCAGGCGCCGCCAGCACCGGAGCTACAGATGCTGACGAGGATGATGCGGCAGGCGGGAAAGGCGAA
AAAAGGAAGAAGAGTAATTACAAGGCTCTCATCAAGGGCATTCCAGGAAAACATTCGATGAAAAAGGACGATTAC
TTGACAAGCATGATGATGATCCCACCGAAGCAACCTACGCGTATCCATCAATTTGACGTCAGGACACAGCAAGAG
GCCTTCGCAGTGAGTCCAGAAGGTTTGAAAGGCTGGAATGTCATGACTTTGATCTTGGAGTCTGCCCAAGCTCGA
GAGGATCGGAAGAAGCGGAAGGAGCTCAAGCGCCTAGCAAAAGCTCAACAGGCACACGCAGCGTTACAGGCTGGT
GCAGCAGCGTCACCTACAGTTGCTCAACCACAACCTCTACGGGCAGCTGCAGGCTCCATGCCACAGAAAAGCGCG
TCTGCTACGCCACAGGTCCAGCAATCACCTTCGTCAATGCCAAAATCAACTGGAACACCAAGACCGGTATCAACT
GCCCCACGCCCAGGATCTACGGTACCACGACCCGGTTCCGCTGTTTCCAAACTCGGTTCTACCATGCGTCCGACT
TCCGCGGCATCACCGAACATTAAACAGGAACAGAAGATGCATACGCTTCCAGTCCAGATTCCTGGGCCACCGGCC
ATGGTCACAACCTCAAGGACAGCGACAGCGACCCCTGATCTGCACAGAGGGAAGAAGAGAGACAGGGACGATGGA
ATGTTATCGAATGTCACGATAAATGGGACTTCTGCGACGGATACTCATGTGAATGGGACGACCCTTAATGGCATT
GGGAATGGAAATGGGTTATCGAAGCTTAATGCCAAGGCGGGCTCTGGTGGTGTGCGACCTAGACCATCTAAAAAG
CAGCGTGTGGACGTGCAAGGGCAGGCAAGGGAAGTCAGCGCTCCCGTCCAACAACCTACACCTCAAGGTGTATAA
Gene >AgabiH97|085370
ATGCGTCCTAGTCTCGCTGTGCAGCGGGATCAAGATCGGGTAATCAAGCACCTACAAAGGACGTGTACAGTAACA
GATTTATACGAACTTTGTTCGTGATCGAAATTCTTATATATATATCCAACCGGCCTTTAACGACATTCCCCTTTG
CACTCATAGACCTTGGGGGTGATTTCACTGAGTCACCGCGCCCTCTTCGTCCCTAACCCTACCCCTTATTATCAA
CTACACAGGTGCAAAGAGCTTGTTGACTATCATCATTGTTCCTATTTGACCCTTTCACAGACACCTACCGCGGAA
TCCGACTAGAATAAGAGTAGCAATCGACTAGAACTGTATAAGTATGACTGGACACGGAGCCGACGTCGCTAGCAC
CAGTAGCAGCCCGCAATTCCCCGCGGCGACGGTTGATTTCGATGAACGCGAACCACTACTATCACGGACGGGGGA
GAATAAGAGACCGAAGAAACCGTTTCATAGAGCTAGGCCATTATGGTGAGTACGCGCTTTGAATCAATTAACGAA
CTCATCATTGATGCGCATACAAGGATTGTACCTTTTGCACTGGTTGTTTCCGTCGTTGTACGCCCTGATCCCCAA
TTATTTCTTCGATAAGCGCTAATTACTAAATATAGCGGGGAATGACGCTCGCGCCTCGAGTGGAGGTGTTCACGC
AACTTTCGTGTCATCGAGTGTATGGTCTCCACAGTCATCCCGCCGCACCATCCACGCCCTTTCCCCATTTGATGA
CTAATATTTCCTCCTTAAACTCTCCTGTTCTTAAAATAACAAATCCGGTATCGGTCCTAGAGTTTGCCTCGCACG
CCCCCGAATCACAGCCATTTTTGCAATTGAGCATCGCAGACGGAGGCAGTATATTTGATTCAGGTAGTAACGATG
AAGACACCATTGAACCAGGCGACGAAACTGGTGATCCTCGAAGTATACCGTCGAATCGATGTGTCAAAGACCCAA
GGGTTCAAGCTGGAGCAGCCAAATTGCAAATGATCATGACTACGAGCATGGGACTGCTCTCCGCATTAACCACGG
GGGCATGGGGACATTTTGGTGAACGCCATGGGCGTACAAGTGTACTTGCTATATCAACTCTGGGATTGTTCCTGA
CGTACGTTGCGTGATCACCGGAATTCCCTGGTCGTGTTGCTAAGGTTTGGTTTTCCAGTGATCTGGCCTTCATCC
TTGCTTCGACCCCGGGTTCAGTTTTTTCGAAGCATGGACACAAGTTTCTCCTCGTGGCACCTGTGATTGAAGGTG
CCCTCGGTGGTTGGTCGACAGTGCAAGCATCCACATCAGCATATATATCAGATTGCACCTCCAGTGGCTCCAGGG
CGCAAGTGTTTTCTCGATTCACGGGCGTTACTTACTTGGGCGTCCTCCTTGGGCCTACTATCAGTGGATACCAGA
TTTCACGTTCTGGTGCCAGTGGCGTCGGGGGAAACAAAAACGTCACTAGCGTGTTTTGGGTGGCGGTGTGTTGTT
CATTCCTAAACTTCTTGGCTGCTGTTTTTGTTTTTCCCGAGTCACTGTCAGAGGAGAAAAGGAGGAAAGCAAGAG
CAGAATATGATGCCAATGGGAAAGGGAAAACGCCCACTGGTGATGGTGTGGTAGCAGAGGGGAGACGAAGAACGA
GCCTTTTTAGGAAGTTGTTTGGACCAATTATAACAGCACCGGTCCAAATCCTATCGGTGTTAGCAGTGTTTCTGC
CAGTGAAAGTGAAGTCGGGTGGTCAATTGGGATCGTATCGGCGAGATTTGAGCCTCACGGCGCTTGGAGTGGCAT
ATTTTTCTTACATGTTGACACTGGTGAGTTTCAATGATTTGTCAATCGGACACTGATTCTGATTGCGCTACGAAC
AGGGATTATATCAACTAAAGTATCTGTATGCTGAACATATGTATGGATGGGGGGCTGAACAGTTGAGCTGGTACA
TCTCATACCTCGGTGGAGTGAGGGCGATAGCATTGTTGGTTATACTTCCTTGTGAGTGTTCGACGTCTCGACCTT
TTTAGAAGCATTGACGTTGATTTCACAAATTGTGCAATTTAGTCCTTATCGGAATACTCAAACCCAAAGCGGTCG
ACTCGGATAAAGGGAAGGACAAAAGCAACGTCACGCCTGTAATAGCAGCAGCAACGCCGGATGGAGGGAAAAGAA
AGCCAACGCGAAGTCAACTTGGCCGCGAAATTGCGTTCGATTTGTCCCTTGTGCGATGTTCCCTCTTGATGGACG
TGGTCTCTGATCTGCTCGTCGTCGTATCACCAGCGCCGATACTTCATGAAACGTCTATCGGAAAGCAGATTTTAA
ACCAAGCTAGCCACGCAAATAGAGGAGCTGTCTCATTGAAATCAAGCCAGACTTTGTTTGTTCTTGCGACCGGGT
TTGCTAGTTTTGGAACAGGCGCGGCACCAGCGATTCATAGTTTGGCGTTGTGTATCCTGCAGGCCAGGGAGACAG
TCTTGCAGCCGACGATGAGGGATGGAGACGAGGAGACGACTGACGTCGAAATGTCGGCGGAACCAGAAGCCAGCA
CGGCTGCCCAGGGTGGAAATGTGGGTGGTGTGTTTGGTGCGTTTGCGTTTTTGCAGGCGATTGGATCAATGATCC
TTGGGGTGAGAATCTACCAATAGTTGTGATGCGTCATGTTACTGATTGCCATGAAACTTTTGCAGCCGTTGCTCT
TTGGGATGGTTTACAGCAGCACGGTGGCCGGGATGCCCAAGGCTATCTTTATGGTGGCGGTTGCATCGCTCTCTG
TGGCGTTGGTGCTGCTGATGTTGGTGAGAAATCCGGTTGGGAAGGACGGGGACACGAAGGGCCAGAAGAGAGCCG
GGGACGTTGCACGGGGGAGATCGCGGGCGAGCAAGGACCTGCGAGGGGGTGCTGCCGGGTACGAGAGCGGGTAGA
CATGACATATTCAAGTTGTATTCCATAGACTCAGTTTAACATATTGTATTTTCCTAGACCAAACAAGGACAAACA
GAGTGAGGGCGTTTCTCGGTTGTTATCACTTTCTCTCTCCCGGCGCTGACATGAACAACTCGAATGCGCTAGCTG
GCCCCTCGTCGCCGCGCACAGACCACCCGCCCCTCTTCCTCCCACCGCCAGGTACTTATACCCTCTCCCACTCGT
CTTTCGCTCACACTCTTCTGCTTTCCAGGCCCGCCGCCACCAAGACAGAACCTCGCGAGCACCCAGGACCTTCTC
TCCCGCTTCCATCTCCTCTCTGCCTACGACAGATATGTTCGCCCATGTGCTACCCAATACGTCCAGGATGGCCAG
TTACGCTCGACTCCCACACCTTCCTCGACGCTTGACAAGGGAAAGGGAAAAGAAGTTGACACCGGCAACCCCTTA
CCACAAGCACAGAACTCCAATCCTCCAGGCGCCGCCAGCACCGGAGCTACAGATGCTGACGAGGATGATGCGGCA
GGCGGGAAAGGCGAAAAAAGGAAGAAGAGTAATTACAAGGCTCTCATCAAGGGCATTCCAGGTGCGGGTTATTGC
TTTGGCACTACTCTACATGTTGCTCATTATTCCGGCACTCGATGCTTTAGGAAAACATTCGATGAAAAAGGACGA
TTACTTGACAAGCATGATGATGATCCCACCGAAGCAACCTACGCGTATCCATCAATTTGACGTCAGGACACAGCA
AGAGGCCTTCGCAGTGAGTCCAGAAGGTTTGAAAGGCGTATGTTCCGTTCTCCTCGTCTGTGATGTCATCTTTTT
TTGACTCATACATCACCTCGGCAATATCTAGTGGAATGTCATGACTTTGATCTTGGAGTCTGCCCAAGCTCGAGA
GGATCGGAAGAAGCGGGTAGGTACCTCTTTGAGTCCCGATGTCACCAATGAATAACTCACTAATACTATCCTCTG
CTGCAGAAGGAGCTCAAGCGCCTAGCAAAAGCTCAACAGGCACACGCAGCGTTACAGGCTGGTGCAGCAGCGTCA
CCTACAGTTGCTCAACCACAACCTCTACGGGCAGCTGCAGGCTCCATGCCACAGAAAAGCGCGTCTGCTACGCCA
CAGGTCCAGCAATCACCTTCGTCAATGCCAAAATCAACTGGAACACCAAGACCGGTATCAACTGCCCCACGCCCA
GGATCTACGGTACCACGACCCGGTTCCGCTGTTTCCAAACTCGGTTCTACCATGCGTCCGACTTCCGCGGCATCA
CCGAACATTAAACAGGAACAGAAGATGCATACGCTTCCAGTCCAGATTCCTGGGCCACCGGCCATGGTCACAACC
TCAAGGACAGCGACAGCGACCCCTGATCTGCACAGAGGGAAGAAGAGAGACAGGGACGATGGAATGTTATCGAAT
GTCACGATAAATGGGACTTCTGCGACGGATACTCATGTGAATGGGACGACCCTTAATGGCATTGGGAATGGAAAT
GGGTTATCGAAGCTTAATGCCAAGGCGGGCTCTGGTGGTGTGCGACCTAGACCATCTAAAAAGCAGCGTGTGGTG
AGTTATCATATCTTGTGCACGGAAGATATTTGGTCTAAGTATATCAGGACGTGCAAGGGCAGGCAAGGGAAGTCA
GCGCTCCCGTCCAACAACCTACACCTCAAGGTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail