Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085350
Gene name
Locationscaffold_5:1782929..1784604
Strand+
Gene length (bp)1675
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 1.1E-52 94 361
PF00734 CBM_1 Fungal cellulose binding domain 3.9E-13 26 53

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 11 377 5.0E-115
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 19 377 5.0E-114
sp|A2QPC3|EGLB_ASPNC Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglB PE=3 SV=1 89 384 7.0E-109
sp|O74706|EGLB_ASPNG Endo-beta-1,4-glucanase B OS=Aspergillus niger GN=eglB PE=1 SV=1 89 384 7.0E-109
sp|A1DME8|EGLB_NEOFI Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglB PE=3 SV=1 89 392 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 11 377 5.0E-115
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 19 377 5.0E-114
sp|A2QPC3|EGLB_ASPNC Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglB PE=3 SV=1 89 384 7.0E-109
sp|O74706|EGLB_ASPNG Endo-beta-1,4-glucanase B OS=Aspergillus niger GN=eglB PE=1 SV=1 89 384 7.0E-109
sp|A1DME8|EGLB_NEOFI Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglB PE=3 SV=1 89 392 2.0E-107
sp|Q1HFS8|EGLB_EMENI Endo-beta-1,4-glucanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglB PE=1 SV=1 86 384 5.0E-107
sp|Q96WQ8|EGLB_ASPKW Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) GN=eglB PE=3 SV=1 89 384 5.0E-107
sp|Q2UPQ4|EGLB_ASPOR Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglB PE=3 SV=1 89 384 1.0E-105
sp|B8MW97|EGLB_ASPFN probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglB PE=3 SV=1 89 384 1.0E-105
sp|Q5BDU5|EGLA_EMENI Endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglA PE=1 SV=1 85 392 9.0E-94
sp|P17974|GUN_RALSL Endoglucanase OS=Ralstonia solanacearum GN=egl PE=1 SV=2 93 392 5.0E-68
sp|P58599|GUN_RALSO Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) GN=egl PE=3 SV=1 93 392 1.0E-67
sp|P23044|GUN_ROBSP Endoglucanase 1 OS=Robillarda sp. (strain Y-20) GN=eg 1 PE=1 SV=2 81 365 2.0E-59
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 1 374 2.0E-56
sp|Q04469|GUN1_CRYFL Endoglucanase 1 OS=Cryptococcus flavus GN=CMC1 PE=2 SV=1 86 392 2.0E-39
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 7 124 7.0E-16
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 8 114 2.0E-13
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 21 73 2.0E-13
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 21 58 5.0E-12
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 21 74 7.0E-12
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 1 65 3.0E-11
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 1 59 2.0E-10
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 1 59 2.0E-10
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 1 59 3.0E-10
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 25 73 3.0E-10
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 11 124 1.0E-09
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 11 124 1.0E-09
sp|P25472|GUND_CLOCE Endoglucanase D OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=celCCD PE=3 SV=1 123 340 3.0E-09
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 24 60 4.0E-09
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 25 64 5.0E-09
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 5 170 2.0E-08
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 21 58 2.0E-08
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 12 60 3.0E-08
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 9 75 1.0E-07
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 21 59 1.0E-07
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 25 59 1.0E-07
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 21 61 2.0E-07
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 8 60 2.0E-07
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 26 57 3.0E-07
sp|P28623|GUND_CLOC7 Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) GN=engD PE=1 SV=2 94 392 9.0E-07
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 15 59 9.0E-07
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 26 57 1.0E-06
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 26 57 1.0E-06
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 26 57 2.0E-06
sp|P21833|GUN1_SCLSC Endoglucanase 1 (Fragment) OS=Sclerotinia sclerotiorum PE=1 SV=1 84 117 3.0E-06
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 9 61 3.0E-06
sp|Q2U2I3|MANF_ASPOR Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manF PE=3 SV=2 9 61 3.0E-06
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 26 57 4.0E-06
sp|Q12714|GUN1_TRILO Endoglucanase EG-1 OS=Trichoderma longibrachiatum GN=egl1 PE=3 SV=1 26 57 6.0E-06
sp|Q9HE18|FAEB_TALFU Feruloyl esterase B OS=Talaromyces funiculosus GN=FAEB PE=1 SV=1 26 57 8.0E-06
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 12 58 1.0E-05
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 12 58 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0071704 organic substance metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0030247 polysaccharide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085350
MKSLFASLVAVVALLTTSALAQQPVWAQCGGIGWTGGTTCVSGTQCVKLNDFYSQCLPGSSTSTNPSPTSTTATQ
NPGDTLCGATRTKFQYFGVNEAGAEFGQQNIPGVLGTDYTWPSPSSIDYFVGKGFNTFRIPFLLERLAPSGITGS
FNSAYLSGLRTIVDYITSKGAHAIIDPHNFMRFNGQVITDANAFATFWTHLSSEFKSNSNVIFDLMNEPNGIDAS
VVYQCMQAAVNAIRDNGATQLIMVEGTSWTGAWTWISSGNGAAFAKLTDPLDNIAIQMHQYLDSDGSGTSDQCVS
STIGGERLQAATQWLKDNNFKGFLGEMGAGSNSACINAVKSAFCTMQAAGGVWIGASWWSAGPWWADYFQSIEPP
NGPSIAQVLPQALMPFL*
Coding >AgabiH97|085350
ATGAAGTCCCTCTTTGCTTCCCTGGTAGCCGTTGTGGCTCTCCTCACCACCTCTGCATTGGCTCAACAGCCCGTA
TGGGCTCAATGCGGTGGGATTGGCTGGACCGGTGGAACAACCTGTGTTTCTGGTACACAATGTGTTAAACTTAAT
GACTTTTATTCCCAGTGCTTGCCAGGGTCTTCCACCTCTACCAATCCTTCACCTACCTCTACTACCGCGACCCAA
AATCCCGGTGATACCCTATGTGGTGCTACCAGGACCAAGTTCCAGTACTTTGGTGTCAATGAAGCCGGTGCTGAA
TTCGGTCAACAGAATATTCCCGGAGTTCTCGGAACAGACTATACCTGGCCGAGCCCCAGCTCCATCGACTACTTT
GTCGGCAAGGGATTCAATACTTTCCGTATTCCCTTCCTGCTGGAGCGTCTTGCTCCCAGCGGTATCACAGGCTCT
TTCAACTCCGCTTACCTGAGTGGTTTGCGTACAATTGTTGACTATATCACCAGCAAGGGCGCACATGCTATCATT
GACCCTCACAATTTCATGCGGTTCAACGGCCAAGTTATCACTGATGCTAATGCATTCGCGACCTTCTGGACACAC
CTCTCCAGTGAATTCAAATCTAATAGCAACGTCATTTTCGATCTCATGAACGAGCCCAATGGCATCGATGCATCG
GTCGTATACCAGTGTATGCAAGCCGCTGTGAATGCTATCCGTGACAATGGTGCTACCCAGCTCATCATGGTAGAG
GGTACTTCATGGACTGGTGCCTGGACATGGATCTCCTCCGGAAATGGAGCTGCCTTTGCGAAGCTCACTGATCCG
CTGGACAACATTGCCATTCAAATGCACCAATACCTCGATTCTGACGGTTCCGGCACTAGCGACCAGTGCGTTTCG
TCGACCATTGGTGGCGAACGACTCCAGGCTGCAACTCAATGGCTCAAGGATAACAACTTCAAGGGTTTCTTGGGC
GAAATGGGTGCTGGCTCGAACTCAGCCTGTATTAATGCTGTCAAGAGCGCTTTCTGTACCATGCAGGCCGCTGGT
GGTGTTTGGATCGGTGCTTCTTGGTGGTCCGCTGGTCCATGGTGGGCTGACTACTTCCAATCTATCGAGCCCCCC
AACGGCCCCTCTATTGCTCAAGTGCTTCCTCAGGCTCTTATGCCCTTCCTTTAA
Transcript >AgabiH97|085350
ATGAAGTCCCTCTTTGCTTCCCTGGTAGCCGTTGTGGCTCTCCTCACCACCTCTGCATTGGCTCAACAGCCCGTA
TGGGCTCAATGCGGTGGGATTGGCTGGACCGGTGGAACAACCTGTGTTTCTGGTACACAATGTGTTAAACTTAAT
GACTTTTATTCCCAGTGCTTGCCAGGGTCTTCCACCTCTACCAATCCTTCACCTACCTCTACTACCGCGACCCAA
AATCCCGGTGATACCCTATGTGGTGCTACCAGGACCAAGTTCCAGTACTTTGGTGTCAATGAAGCCGGTGCTGAA
TTCGGTCAACAGAATATTCCCGGAGTTCTCGGAACAGACTATACCTGGCCGAGCCCCAGCTCCATCGACTACTTT
GTCGGCAAGGGATTCAATACTTTCCGTATTCCCTTCCTGCTGGAGCGTCTTGCTCCCAGCGGTATCACAGGCTCT
TTCAACTCCGCTTACCTGAGTGGTTTGCGTACAATTGTTGACTATATCACCAGCAAGGGCGCACATGCTATCATT
GACCCTCACAATTTCATGCGGTTCAACGGCCAAGTTATCACTGATGCTAATGCATTCGCGACCTTCTGGACACAC
CTCTCCAGTGAATTCAAATCTAATAGCAACGTCATTTTCGATCTCATGAACGAGCCCAATGGCATCGATGCATCG
GTCGTATACCAGTGTATGCAAGCCGCTGTGAATGCTATCCGTGACAATGGTGCTACCCAGCTCATCATGGTAGAG
GGTACTTCATGGACTGGTGCCTGGACATGGATCTCCTCCGGAAATGGAGCTGCCTTTGCGAAGCTCACTGATCCG
CTGGACAACATTGCCATTCAAATGCACCAATACCTCGATTCTGACGGTTCCGGCACTAGCGACCAGTGCGTTTCG
TCGACCATTGGTGGCGAACGACTCCAGGCTGCAACTCAATGGCTCAAGGATAACAACTTCAAGGGTTTCTTGGGC
GAAATGGGTGCTGGCTCGAACTCAGCCTGTATTAATGCTGTCAAGAGCGCTTTCTGTACCATGCAGGCCGCTGGT
GGTGTTTGGATCGGTGCTTCTTGGTGGTCCGCTGGTCCATGGTGGGCTGACTACTTCCAATCTATCGAGCCCCCC
AACGGCCCCTCTATTGCTCAAGTGCTTCCTCAGGCTCTTATGCCCTTCCTTTAA
Gene >AgabiH97|085350
ATGAAGTCCCTCTTTGCTTCCCTGGTAGCCGTTGTGGCTCTCCTCACCACCTCTGCATTGGCTCAACAGCCCGTA
TGGGCTCAATGCGGTGTAAGTTTTCCAGCCGACAATCTAATGTGGTACTAGTGTTAAATCATTTGTTGATATTAG
GGGATTGGCTGGACCGGTGGAACAACCTGTGTTTCTGGTACACAATGTGTTAAACTTAATGACTGTGGGTTTACT
CCAACATTATTATCCGAAGGAATTTGACCTCACCCAGTACAATAGTTTATTCCCAGTGCTTGCCAGGGTCTTCCA
CCTCTACCAATCCTTCACCTACCTCTACTACCGCGACCCAAAATCCCGGTGATACCCTATGTGGTGCTACCAGGA
CCAAGTTCCAGTACTTTGGTGTCAATGAAGCCGGTGCTGAATTCGGTCAACAGAATATTCCCGTTCGTTTCTTTT
TCCAATTCGGCGATGCTAGATTGAATACTTCGTATAGGGAGTTCTCGGAACAGACTATACCTGGCCGAGCCCCAG
CTCCATCGACTACTTTGTCGGCAAGGGATTCAATACTTTCCGTATTCCCTTCCTGCTGGAGCGTCTTGCTCCCAG
CGGTATCACAGGCTCTTTCAACTCCGCTTACCTGAGTGGTTTGCGTACAGTAAGTCTCAAACAAGAAAGTCGGGA
TCACGCATTGTATTAACCTTCCCCGCAGATTGTTGACTATATCACCAGCAAGGGCGCACATGCTATCATTGACCC
TCACAATTTCATGCGGTTCAACGGCCAAGTTATCACTGATGCTAATGCGTGAGTATTCTTGTTACGGGTAAAATA
TTATTATCTTGTTGAGCGTTTCTTGTCCAGATTCGCGACCTGTAGGTGTTTCTATCATCAAGAATTGACTTTTCT
TTATCGAGCATCTAGTCTGGACACACCTCTCCAGTGAATTCAAATCTAATAGCAACGTCATTTTCGATCTCATGA
ACGAGCCCAATGGCATCGATGCATCGGTCGTATACCAGTGTGTACGTGATCTTCGCATGTTTTCGGCGAAAATCA
GCTCCTCATGTCCCAATAGATGCAAGCCGCTGTGAATGCTATCCGTGACAATGGTGCTACCCAGCTCATCATGGT
AGAGGGTACTTGTAAGTAACCCTTCATGGTCCTGCAGATCAGCCTTCCTTACCAATCGATGTGATTTAGCATGGA
CTGGTGCCTGGACATGGATCTCCTCCGGAAATGGAGCTGCCTTTGCGAAGCTCACTGATCCGCTGGACAACATTG
CCATTCAAATGCACCAATACCTCGATTCTGACGGTTCCGGCACTAGCGACCAGTGCGTTTCGTCGACCATTGGTG
GCGAACGACTCCAGGCTGCAACTCAATGGCTCAAGGATAACAACTTCAAGGGTTTCTTGGGCGAAATGGGTGCTG
GCTCGAACTCAGCCTGTATTAATGCTGTCAAGAGCGCTTTCTGTACCATGCAGGCCGCTGGTGGTGTTTGGATCG
GTGCTTCTTGGTGGTCCGCTGGTCCATGGTGGGCTGACGTACGTTTTCTATTCCATTCTTGGACAAGCAATGCTT
GACGTGGAAATCCTTTGTCTAGTACTTCCAATCTATCGAGCCCCCCAACGGCCCCTCTATTGCTCAAGTGCTTCC
TCAGGCTCTTATGCCCTTCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail