Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085240
Gene name
Locationscaffold_5:1755636..1757485
Strand-
Gene length (bp)1849
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 8.2E-36 33 295
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.3E-08 54 187
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.1E-10 35 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P93732|PIP_ARATH Proline iminopeptidase OS=Arabidopsis thaliana GN=PIP PE=2 SV=3 2 314 3.0E-140
sp|O83041|PIP_LEPBY Probable proline iminopeptidase OS=Leptolyngbya boryana GN=pip PE=3 SV=1 2 312 1.0E-132
sp|Q9PD69|PIP_XYLFA Proline iminopeptidase OS=Xylella fastidiosa (strain 9a5c) GN=pip PE=3 SV=1 2 311 2.0E-128
sp|Q87DF8|PIP_XYLFT Proline iminopeptidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pip PE=3 SV=1 2 311 7.0E-127
sp|P52279|PIP_XANCI Proline iminopeptidase OS=Xanthomonas citri GN=pip PE=1 SV=2 2 312 5.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P93732|PIP_ARATH Proline iminopeptidase OS=Arabidopsis thaliana GN=PIP PE=2 SV=3 2 314 3.0E-140
sp|O83041|PIP_LEPBY Probable proline iminopeptidase OS=Leptolyngbya boryana GN=pip PE=3 SV=1 2 312 1.0E-132
sp|Q9PD69|PIP_XYLFA Proline iminopeptidase OS=Xylella fastidiosa (strain 9a5c) GN=pip PE=3 SV=1 2 311 2.0E-128
sp|Q87DF8|PIP_XYLFT Proline iminopeptidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pip PE=3 SV=1 2 311 7.0E-127
sp|P52279|PIP_XANCI Proline iminopeptidase OS=Xanthomonas citri GN=pip PE=1 SV=2 2 312 5.0E-122
sp|O32449|PIP_SERMA Proline iminopeptidase OS=Serratia marcescens GN=pip PE=1 SV=1 2 312 2.0E-111
sp|Q9JZR6|PIP_NEIMB Proline iminopeptidase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pip PE=3 SV=1 2 309 6.0E-108
sp|P42786|PIP_NEIGO Proline iminopeptidase OS=Neisseria gonorrhoeae GN=pip PE=1 SV=1 2 309 8.0E-108
sp|Q9JUV1|PIP_NEIMA Proline iminopeptidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pip PE=3 SV=1 2 309 2.0E-107
sp|Q9S2L4|PIP_STRCO Probable proline iminopeptidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1989 PE=3 SV=1 2 312 6.0E-66
sp|P75092|PIP_MYCPN Putative proline iminopeptidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pip PE=3 SV=1 8 298 6.0E-58
sp|P47266|PIP_MYCGE Putative proline iminopeptidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pip PE=3 SV=1 12 297 9.0E-58
sp|C0ZKI1|PIP_BREBN Proline iminopeptidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pip PE=3 SV=1 22 293 4.0E-13
sp|P46541|PIP_BACCO Proline iminopeptidase OS=Bacillus coagulans GN=pip PE=1 SV=2 9 293 2.0E-11
sp|Q890D8|PIP_LACPL Proline iminopeptidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pip PE=3 SV=2 23 295 2.0E-11
sp|P52278|PIP_LACHE Proline iminopeptidase OS=Lactobacillus helveticus GN=pip PE=1 SV=1 23 126 9.0E-10
sp|A8YWL3|PIP_LACH4 Proline iminopeptidase OS=Lactobacillus helveticus (strain DPC 4571) GN=pip PE=3 SV=1 23 126 9.0E-10
sp|B0SW62|RUTD_CAUSK Putative aminoacrylate hydrolase RutD OS=Caulobacter sp. (strain K31) GN=rutD PE=3 SV=1 14 293 1.0E-09
sp|Q5FMT1|PIP_LACAC Proline iminopeptidase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pip PE=3 SV=1 23 126 2.0E-09
sp|D5H0J3|PIP_LACCS Proline iminopeptidase OS=Lactobacillus crispatus (strain ST1) GN=pip PE=3 SV=1 23 126 6.0E-09
sp|Q400K3|MHPC2_PSEPU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 2 OS=Pseudomonas putida GN=mhpC2 PE=3 SV=1 35 296 1.0E-08
sp|Q03NE0|PIP_LACBA Proline iminopeptidase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pip PE=3 SV=1 3 130 1.0E-08
sp|P46544|PIP_LACDE Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pepIP PE=1 SV=2 23 138 2.0E-08
sp|Q1G8L9|PIP_LACDA Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pepIP PE=3 SV=1 23 138 2.0E-08
sp|P46542|PIP_LACDL Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pip PE=1 SV=1 23 138 3.0E-08
sp|C7TMK0|PIP_LACRL Proline iminopeptidase OS=Lactobacillus rhamnosus (strain Lc 705) GN=pip PE=3 SV=1 3 295 2.0E-07
sp|Q13QH4|MHPC_BURXL 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Burkholderia xenovorans (strain LB400) GN=mhpC PE=3 SV=1 22 132 4.0E-07
sp|Q184M8|PIP_PEPD6 Proline iminopeptidase OS=Peptoclostridium difficile (strain 630) GN=pip PE=3 SV=1 23 138 2.0E-06
sp|P49323|PRXC_STRLI Non-heme chloroperoxidase OS=Streptomyces lividans GN=cpo PE=1 SV=2 12 130 2.0E-06
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 6 147 5.0E-06
sp|D5VGV3|RUTD_CAUST Putative aminoacrylate hydrolase RutD OS=Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) GN=rutD PE=3 SV=1 11 130 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085240
MLYQPIEPYETGTIKVSDIHTLYYEISGKKDGNPVVFLHGGPGGGTNASDRTFFNPDKYKIVLLDQRGAGNSTPS
ACLEENTTWDLVSDIEKLRAKLDIEKWHVFGGSWGSTLSLAYAQSHPDRIKSLVLRGIFTLRKSELRFFYQDGAS
HIFPDAWDEYLAPIPESEREDLISAYHKRLNSDDEDTRIKAATAWSKWEMWTSKLHVDPVHIAHADDSKFANAFA
RIENHYFVNGGFMRDGQLLEKQSVDKIRHIPTVIVQGRYDVVCPATTAYALKKVFPEATLHIVPDAGHSAREPGI
SKLLVEATDKFADL*
Coding >AgabiH97|085240
ATGTTGTACCAGCCCATTGAGCCCTATGAGACTGGCACCATCAAGGTTTCTGACATTCACACACTCTATTATGAG
ATTTCCGGTAAAAAGGACGGGAATCCAGTCGTATTCCTCCACGGTGGCCCGGGAGGGGGGACCAATGCGAGCGAT
CGTACTTTCTTCAACCCTGATAAATACAAGATTGTCCTTCTCGACCAACGGGGTGCGGGAAACTCTACTCCGAGT
GCATGCTTGGAAGAAAACACCACTTGGGACCTTGTGAGTGATATCGAGAAGTTAAGAGCAAAGTTGGATATCGAG
AAATGGCACGTTTTTGGTGGATCTTGGGGATCCACACTTTCGTTGGCATATGCCCAGTCTCATCCTGATCGAATC
AAGTCTCTTGTTTTGCGGGGAATTTTTACTTTACGCAAAAGTGAACTGCGGTTCTTCTATCAAGACGGGGCCTCT
CATATTTTCCCGGATGCTTGGGATGAATATTTGGCACCTATCCCTGAGTCTGAACGTGAAGATCTTATCTCTGCT
TACCACAAGCGACTCAACTCGGATGATGAAGACACCCGTATAAAGGCGGCGACAGCGTGGTCCAAGTGGGAGATG
TGGACTTCCAAGCTCCATGTCGATCCGGTTCATATTGCGCATGCTGATGATAGCAAATTCGCCAACGCTTTCGCT
CGGATTGAAAATCACTATTTTGTAAACGGGGGATTCATGAGGGATGGTCAGCTACTCGAGAAACAATCTGTTGAT
AAGATCCGCCATATCCCTACTGTCATCGTCCAAGGGCGGTACGACGTAGTTTGTCCAGCTACGACCGCGTATGCA
TTGAAGAAGGTATTCCCGGAAGCGACGTTGCACATTGTTCCAGACGCCGGTCACTCTGCCCGCGAGCCTGGTATC
TCAAAGCTTCTTGTGGAGGCCACAGACAAGTTTGCAGATCTTTGA
Transcript >AgabiH97|085240
ATGTTGTACCAGCCCATTGAGCCCTATGAGACTGGCACCATCAAGGTTTCTGACATTCACACACTCTATTATGAG
ATTTCCGGTAAAAAGGACGGGAATCCAGTCGTATTCCTCCACGGTGGCCCGGGAGGGGGGACCAATGCGAGCGAT
CGTACTTTCTTCAACCCTGATAAATACAAGATTGTCCTTCTCGACCAACGGGGTGCGGGAAACTCTACTCCGAGT
GCATGCTTGGAAGAAAACACCACTTGGGACCTTGTGAGTGATATCGAGAAGTTAAGAGCAAAGTTGGATATCGAG
AAATGGCACGTTTTTGGTGGATCTTGGGGATCCACACTTTCGTTGGCATATGCCCAGTCTCATCCTGATCGAATC
AAGTCTCTTGTTTTGCGGGGAATTTTTACTTTACGCAAAAGTGAACTGCGGTTCTTCTATCAAGACGGGGCCTCT
CATATTTTCCCGGATGCTTGGGATGAATATTTGGCACCTATCCCTGAGTCTGAACGTGAAGATCTTATCTCTGCT
TACCACAAGCGACTCAACTCGGATGATGAAGACACCCGTATAAAGGCGGCGACAGCGTGGTCCAAGTGGGAGATG
TGGACTTCCAAGCTCCATGTCGATCCGGTTCATATTGCGCATGCTGATGATAGCAAATTCGCCAACGCTTTCGCT
CGGATTGAAAATCACTATTTTGTAAACGGGGGATTCATGAGGGATGGTCAGCTACTCGAGAAACAATCTGTTGAT
AAGATCCGCCATATCCCTACTGTCATCGTCCAAGGGCGGTACGACGTAGTTTGTCCAGCTACGACCGCGTATGCA
TTGAAGAAGGTATTCCCGGAAGCGACGTTGCACATTGTTCCAGACGCCGGTCACTCTGCCCGCGAGCCTGGTATC
TCAAAGCTTCTTGTGGAGGCCACAGACAAGTTTGCAGATCTTTGA
Gene >AgabiH97|085240
ATGTTGTACCAGCCCATTGAGCCCTATGAGACTGGCACCATCAAGGTTTCTGACATTCACACACTCTAGTATGCT
GTTTTCTCTGGCACTCAGATCTAAACTGATAGCAGAACATGGGTCTACTTAAAGTTATGAGATTTCCGGTAAAAA
GGACGGGAATCCAGGTGCGTAGTTTGAAAATTAAGTCGGATCCAGTCTGACGCGTATGTTCAGTCGTATTCCTCC
ACGGTTGGTTTGTCCCGCGACCTCTTTTGCCTTCGTCGTTACACATAAAACAGGTGGCCCGGGAGGGGGGACCAA
TGCGAGCGATCGTACTTTCTTCAACCCTGATAAATACAAGGTTCCCTAACTGGCAGGCTACTTTCTCTTTCCTAA
CGCTGATTCACTTGAATGACTTTAGATTGTCCTTCTCGACCAACGGGGTGCGGGAAACTCTACTCCGTGAGCTCT
CTTTATTAGAAGTAATATGAACTCACGACTCATCGATTTTGTAGGAGTGCATGCTTGGAAGAAAACACCACTTGG
GACCTTGTGAGTGATATCGAGAAGTTAAGAGCAAAGTTGGATATCGAGAAATGGCACGTTTTTGGTGGATCTTGG
GTGCATACCACTCTAGTTGCCGCATTCACCCTTGTTCATACTTGATGTAGGGATCCACACTTTCGTTGGCATATG
CCCAGGTAGGTGCCATTTACCATTCTCATGTGATATGATGATCGACCGCCTCGTCCCTCCTAGTCTCATCCTGAT
CGAATCAAGTCTCTTGTTTTGCGGTGAGGAAGCAATTTGCCCAAAAGTTCTGAGGAATTGATCACCTCGTAGGGG
AATTTTTACTTTACGCAAAAGGTGTGTCCTCATGGATAATCGATCAGTCCCGTGAATATACATATAATTTAGTGA
ACTGCGGTTCTTCTATCAAGACGGGGCCTCTCATATTTTCCCGGATGCTTGGTATGTGTTTGACATCTCAAGCAC
ACACCACCTTCTCTAATGCTCTTTTGATTATCTTTGCAGGGATGAATATTTGGCACCTATCCCTGAGTCTGAACG
TGAAGATCTTATCTCTGCTTACCACAAGCGACTCAACTCGGATGATGAAGACACCCGTATAAAGGCGGCGACAGC
GTGGTCCAAGTGGGAGTGGGTGCCTCTCCTTCTAATTTGAAGCTGTTTCTTCTTACTCAGAGTTTATCAGGATGT
GGACTTCCAAGCTCCATGTCGATCCGGTTCATATTGCGCATGCTGATGATAGCAAATTCGCCAAGTATGTTGGAT
ATTTGTTCGCTATCACAATTATTAACCAGATTCCATTTTAGCGCTTTCGCTCGGATTGAAAATCACTATTTTGTA
AACGGGGTTCGTAAGCTTCGCGATGGTATATCTGGATGTAACATCATCTCCTCCTCAGGGATTCATGAGGGATGG
TCAGCTACTCGAGAAACAATCTGTTGATAAGATGTAAATTTCTCCTTCTATGCTTGTGCAAAAGCCTGACAGTTC
CAGCCGCCATATCCCTACTGTCATCGTCCAAGGGCGGTACGACGTAGTTTGTCCAGTAAGTCTGTTGCTTAGTAC
CAATCAATCTCGAGCGCTGACACATTAATCACCATAGGCTACGACCGCGTATGCATTGAAGAAGGTTGGTCCACA
AACTTAGTCTCCATACATTACTTAGTAGTGTATCCATCAAGGTATTCCCGGAAGCGACGTTGCACATTGTTCCAG
ACGCCGGTCACTCTGCCCGCGAGCCTGGTATCTCAAAGCTTCTTGTGGAGGTGAGACCTTAGCTTTAGGTCGCGA
TTGTCACTCATCCCAGCTGTAGGCCACAGACAAGTTTGCAGATCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail