Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085210
Gene name
Locationscaffold_5:1749333..1750589
Strand+
Gene length (bp)1256
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 2.3E-15 173 262
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 8.9E-09 32 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 5 341 2.0E-25
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 9 339 8.0E-25
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 4 340 3.0E-24
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 26 340 9.0E-22
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 14 252 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 5 341 2.0E-25
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 9 339 8.0E-25
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 4 340 3.0E-24
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 26 340 9.0E-22
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 14 252 7.0E-21
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 8 240 2.0E-20
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 27 339 2.0E-20
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 27 339 3.0E-20
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 26 211 3.0E-20
sp|Q941I0|ENOXC_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 26 340 4.0E-20
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 26 340 4.0E-20
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 27 211 1.0E-19
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 20 314 3.0E-19
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 20 314 3.0E-19
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 20 314 6.0E-19
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 26 340 7.0E-19
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 20 280 1.0E-18
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 20 280 1.0E-18
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 20 314 7.0E-18
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 29 274 3.0E-17
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 4 245 8.0E-17
sp|P0DN30|RTAI1_ARTBC Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 20 222 2.0E-15
sp|Q54II4|RT4I1_DICDI Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=rtn4ip1 PE=3 SV=1 27 270 3.0E-15
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 33 277 2.0E-14
sp|O13309|ADH2_PICST Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 3 263 4.0E-14
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 27 306 6.0E-14
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 26 193 7.0E-14
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 26 193 1.0E-13
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 4 211 1.0E-13
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 18 193 1.0E-13
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 26 194 2.0E-13
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 26 193 2.0E-13
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 9 211 3.0E-13
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 4 276 4.0E-13
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 25 259 5.0E-13
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 4 211 6.0E-13
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 6 259 7.0E-13
sp|Q9P6C8|ADH1_NEUCR Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 1 227 9.0E-13
sp|Q82LU9|CCRA2_STRAW Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 27 213 2.0E-12
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 27 211 3.0E-12
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 32 270 5.0E-12
sp|O00097|ADH1_PICST Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 3 220 8.0E-12
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 19 207 1.0E-11
sp|O74822|YBJB_SCHPO Zinc-type alcohol dehydrogenase-like protein C337.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.11 PE=3 SV=1 6 194 2.0E-11
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 3 263 4.0E-11
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 34 342 6.0E-11
sp|Q3IZ91|CCR_RHOS4 Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 64 212 7.0E-11
sp|P0DMQ6|DHSO_CHICK Sorbitol dehydrogenase OS=Gallus gallus GN=SORD PE=1 SV=1 16 260 1.0E-10
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 29 258 1.0E-10
sp|P43067|ADH1_CANAX Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 3 263 2.0E-10
sp|Q53865|CCR_STRCU Crotonyl-CoA reductase OS=Streptomyces collinus GN=ccr PE=1 SV=1 27 213 2.0E-10
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 26 193 7.0E-10
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 32 214 9.0E-10
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 9 223 1.0E-09
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 32 238 3.0E-09
sp|P49383|ADH2_KLULA Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 3 220 4.0E-09
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 28 220 4.0E-09
sp|P20369|ADH1_KLULA Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 4 276 5.0E-09
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 1 337 6.0E-09
sp|Q9P4C2|ADH2_KLUMA Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 4 276 6.0E-09
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 1 337 6.0E-09
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 32 211 1.0E-08
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 4 248 3.0E-08
sp|P00331|ADH2_YEAST Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 3 337 4.0E-08
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 28 267 7.0E-08
sp|B6YTJ5|TDH_THEON Probable L-threonine 3-dehydrogenase OS=Thermococcus onnurineus (strain NA1) GN=tdh PE=3 SV=1 27 282 8.0E-08
sp|P41747|ADH1_ASPFN Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2 4 242 8.0E-08
sp|P08843|ADH1_EMENI Alcohol dehydrogenase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcA PE=3 SV=2 3 227 8.0E-08
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 32 258 1.0E-07
sp|Q9Z9U1|DHSO_BACHD Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 18 133 1.0E-07
sp|C1D195|TDH_DEIDV L-threonine 3-dehydrogenase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=tdh PE=3 SV=1 14 330 1.0E-07
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 19 333 1.0E-07
sp|Q58D31|DHSO_BOVIN Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3 18 260 1.0E-07
sp|Q9XXC8|MECR2_CAEEL Probable trans-2-enoyl-CoA reductase 2, mitochondrial OS=Caenorhabditis elegans GN=Y48A6B.9 PE=3 SV=1 22 210 2.0E-07
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 20 211 5.0E-07
sp|Q3J6K9|ACUI_RHOS4 Acrylyl-CoA reductase AcuI OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=acuI PE=1 SV=1 33 213 1.0E-06
sp|Q5JI69|TDH_THEKO Probable L-threonine 3-dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tdh PE=1 SV=1 27 282 1.0E-06
sp|Q8U259|TDH_PYRFU Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 27 281 2.0E-06
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 22 263 2.0E-06
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 9 211 2.0E-06
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 19 258 2.0E-06
sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=4 18 260 2.0E-06
sp|O58389|TDH_PYRHO Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 27 211 2.0E-06
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 4 263 3.0E-06
sp|Q86ZV0|XYL2_ASPOR D-xylulose reductase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xdhA PE=3 SV=2 49 255 3.0E-06
sp|Q9UYX0|TDH_PYRAB Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 27 281 3.0E-06
sp|P07846|DHSO_SHEEP Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1 18 260 4.0E-06
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 19 141 4.0E-06
sp|Q5SKS4|TDH_THET8 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tdh PE=1 SV=1 8 95 4.0E-06
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 9 142 5.0E-06
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 3 211 7.0E-06
sp|Q72L62|TDH_THET2 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tdh PE=3 SV=1 8 95 8.0E-06
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 19 185 8.0E-06
sp|Q6CTQ5|YIM1_KLULA Protein YIM1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YIM1 PE=3 SV=2 31 210 8.0E-06
sp|F2Z678|ADH2_YARLI Alcohol dehydrogenase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADH2 PE=1 SV=1 2 333 9.0E-06
sp|Q2K618|TDH_RHIEC L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tdh PE=3 SV=1 4 211 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085210
MPELPQQQKALFLESKQGDFVVKTRAVPKPGPGQALIQVKAAALNPVDWKIQKYGIYVTDFPAILGTDVSGVIVA
IGEGITKFNVGDKVFCQGKIELDYADFQQYALVDEHHLAKIPANINFDQAATMPLGVTTAFLLMYNKPPHGHGLV
NPIEAPGHYKDQPFVVLGGSANVGQNAIQFAKLSGFNPIIATASLKHTDFLKSLGATHVLDRNLSVQALKAEIEK
ITTKPVKHVCDAISVAETQQTGVEILAPGGHLMLVLAPTVSSDDKHILNVVAFRHLEPNVEQITAMYGKLSEWVE
KGIIKPNNVEVLPGGLNGIVGGFKRMEANQVSGLKLVVHPEETA*
Coding >AgabiH97|085210
ATGCCTGAATTACCTCAACAACAAAAAGCCCTTTTCCTCGAATCTAAACAAGGCGACTTCGTCGTAAAGACTCGT
GCCGTTCCCAAACCAGGCCCTGGACAAGCCTTGATTCAAGTCAAGGCAGCAGCGTTGAATCCTGTGGATTGGAAG
ATCCAGAAGTACGGCATCTATGTCACTGATTTTCCCGCCATCCTTGGGACGGACGTCTCTGGAGTCATTGTCGCG
ATTGGCGAGGGAATTACTAAGTTCAACGTCGGCGACAAGGTGTTTTGTCAGGGCAAAATCGAACTCGACTACGCG
GATTTTCAACAGTATGCATTAGTAGATGAACATCATCTTGCCAAGATTCCTGCAAACATCAACTTTGATCAAGCT
GCTACTATGCCGCTGGGAGTGACTACAGCTTTTCTGTTGATGTATAACAAACCCCCACATGGACATGGTCTTGTT
AATCCTATTGAAGCGCCTGGCCATTATAAAGATCAGCCTTTCGTCGTGTTGGGAGGATCTGCCAATGTTGGTCAA
AATGCAATTCAATTCGCAAAACTCTCTGGGTTTAATCCCATCATCGCCACTGCATCTCTCAAGCACACTGATTTC
CTCAAATCACTTGGAGCAACTCACGTTCTCGATCGTAACCTATCCGTTCAGGCTCTCAAAGCTGAAATTGAAAAG
ATTACGACTAAGCCTGTCAAACATGTCTGCGATGCTATATCAGTAGCCGAGACCCAACAGACAGGAGTTGAGATT
CTGGCTCCGGGTGGTCATCTTATGCTCGTCCTCGCTCCTACAGTTAGTTCTGACGACAAGCACATTCTCAATGTT
GTCGCATTCCGTCATTTGGAGCCGAATGTTGAACAGATAACTGCCATGTACGGCAAGTTGTCAGAGTGGGTGGAA
AAAGGAATTATCAAGCCCAATAATGTGGAAGTGCTCCCAGGTGGGTTGAACGGTATTGTAGGAGGATTCAAGAGG
ATGGAGGCCAACCAGGTTTCCGGTCTCAAATTGGTTGTTCATCCGGAGGAGACTGCTTAA
Transcript >AgabiH97|085210
ATGCCTGAATTACCTCAACAACAAAAAGCCCTTTTCCTCGAATCTAAACAAGGCGACTTCGTCGTAAAGACTCGT
GCCGTTCCCAAACCAGGCCCTGGACAAGCCTTGATTCAAGTCAAGGCAGCAGCGTTGAATCCTGTGGATTGGAAG
ATCCAGAAGTACGGCATCTATGTCACTGATTTTCCCGCCATCCTTGGGACGGACGTCTCTGGAGTCATTGTCGCG
ATTGGCGAGGGAATTACTAAGTTCAACGTCGGCGACAAGGTGTTTTGTCAGGGCAAAATCGAACTCGACTACGCG
GATTTTCAACAGTATGCATTAGTAGATGAACATCATCTTGCCAAGATTCCTGCAAACATCAACTTTGATCAAGCT
GCTACTATGCCGCTGGGAGTGACTACAGCTTTTCTGTTGATGTATAACAAACCCCCACATGGACATGGTCTTGTT
AATCCTATTGAAGCGCCTGGCCATTATAAAGATCAGCCTTTCGTCGTGTTGGGAGGATCTGCCAATGTTGGTCAA
AATGCAATTCAATTCGCAAAACTCTCTGGGTTTAATCCCATCATCGCCACTGCATCTCTCAAGCACACTGATTTC
CTCAAATCACTTGGAGCAACTCACGTTCTCGATCGTAACCTATCCGTTCAGGCTCTCAAAGCTGAAATTGAAAAG
ATTACGACTAAGCCTGTCAAACATGTCTGCGATGCTATATCAGTAGCCGAGACCCAACAGACAGGAGTTGAGATT
CTGGCTCCGGGTGGTCATCTTATGCTCGTCCTCGCTCCTACAGTTAGTTCTGACGACAAGCACATTCTCAATGTT
GTCGCATTCCGTCATTTGGAGCCGAATGTTGAACAGATAACTGCCATGTACGGCAAGTTGTCAGAGTGGGTGGAA
AAAGGAATTATCAAGCCCAATAATGTGGAAGTGCTCCCAGGTGGGTTGAACGGTATTGTAGGAGGATTCAAGAGG
ATGGAGGCCAACCAGGTTTCCGGTCTCAAATTGGTTGTTCATCCGGAGGAGACTGCTTAA
Gene >AgabiH97|085210
ATGCCTGAATTACCTCAACAACAAAAAGCCCTTTTCCTCGAATCTAAACAAGGCGACTTCGTCGTAAAGACTCGT
GCCGTTCCCAAACCAGGCCCTGGACAAGCCTTGATTCAAGTCAAGGCAGCAGCGTTGAATCCTGTGGATTGGAAG
ATCCAGAAGTACGGCATCTATGTCACTGATTTTCCCGCCATCCTTGGGACGGACGTCTCTGGAGTCATTGTCGCG
ATTGGCGAGGGAATTACTAAGTTCAACGTCGGCGACAAGGTGTAAGTTATCCGCATATATGCATCGTGCTTTCTT
ACACGCGGAATTCAGGTTTTGTCAGGGCAAAATCGAACTCGACTACGCGGATTTTCAACAGTATGCATTAGTAGA
TGAACATCATCTTGCCAAGGTAAGCATATATTCACATTTTGAGCGTAGAATTAACGCGAATTTTGAAGATTCCTG
CAAACATCAACTTTGATCAAGCTGCTACTATGCCGCTGGGAGTGACTACAGCTTTTCTGTTGATGTATAACAAAC
CCCCACATGGACATGGTCTTGTTAATCCTATTGAAGCGCCTGGCCATTATAAAGATCAGCCTTTCGTCGTGTTGG
GAGGATCTGCCAATGTTGGTCAAAATGGTTTGTTTTATTTTTTCTACATTCCCATCCATCCGAGCCGATTGCTGA
CCTTTTCCATTGTAGCAATTCAATTCGCAAAACTCTCTGGGTTTAATCCCATCATCGCCACTGCATCTCTCAAGC
ACACTGATTTCCTCAAATCACTTGGAGCAACTCACGTTCTCGATCGTAACCTATCCGTTCAGGCTCTCAAAGCTG
AAATTGAAAAGATTACGACTAAGCCTGTCAAACATGTCTGCGATGCTATATCAGTAGCCGAGACCCAACAGACAG
GAGTTGAGATTCTGGCTCCGGGTGGTCATCTTATGCTCGTCCTCGCTCCTACAGTTAGTTCTGACGACAAGCACA
TTCTCAATGTTGTCGCATTCCGTCATTTGGAGCCGAATGTTGAACAGATAACTGCCATGTACGGCAAGTTGTCAG
AGTGGGTGGAAAAAGGAATTATCAAGGTTCGTTTATCCTGGGATGATTTGTCTATTCGTATTTTCATTAAACATC
TCGGTTTACAGCCCAATAATGTGGAAGTGCTCCCAGGTGGGTTGAACGGTATTGTAGGAGGATTCAAGAGGATGG
AGGCCAACCAGGTTTCCGGTCTCAAATTGGTTGTTCATCCGGAGGAGACTGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail