Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|085170
Gene name
Locationscaffold_5:1734933..1737291
Strand-
Gene length (bp)2358
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00485 PRK Phosphoribulokinase / Uridine kinase family 6.0E-48 59 241
PF14681 UPRTase Uracil phosphoribosyltransferase 3.2E-40 299 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 29 527 2.0E-123
sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 29 527 3.0E-122
sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 40 495 3.0E-104
sp|Q9LK34|UKL2_ARATH Uridine kinase-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=UKL2 PE=2 SV=1 58 527 6.0E-93
sp|Q9LTY6|UKL5_ARATH Uridine kinase-like protein 5 OS=Arabidopsis thaliana GN=UKL5 PE=2 SV=1 58 527 6.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 29 527 2.0E-123
sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 29 527 3.0E-122
sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 40 495 3.0E-104
sp|Q9LK34|UKL2_ARATH Uridine kinase-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=UKL2 PE=2 SV=1 58 527 6.0E-93
sp|Q9LTY6|UKL5_ARATH Uridine kinase-like protein 5 OS=Arabidopsis thaliana GN=UKL5 PE=2 SV=1 58 527 6.0E-92
sp|Q8VYB2|UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana GN=UKL3 PE=2 SV=1 39 527 2.0E-91
sp|Q9FKS0|UKL1_ARATH Uridine kinase-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=UKL1 PE=1 SV=1 58 527 2.0E-91
sp|O65583|UKL4_ARATH Uridine kinase-like protein 4 OS=Arabidopsis thaliana GN=UKL4 PE=2 SV=2 58 527 2.0E-90
sp|O74427|URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urk1 PE=3 SV=1 44 491 4.0E-88
sp|P27515|URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URK1 PE=1 SV=1 70 467 2.0E-78
sp|Q7ZV79|UCK2B_DANRE Uridine-cytidine kinase 2-B OS=Danio rerio GN=uck2b PE=2 SV=1 48 274 3.0E-53
sp|Q8T154|UCKB_DICDI Uridine-cytidine kinase B OS=Dictyostelium discoideum GN=udkB PE=3 SV=2 58 268 7.0E-53
sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1 37 256 3.0E-52
sp|Q9QYG8|UCK2_RAT Uridine-cytidine kinase 2 OS=Rattus norvegicus GN=Uck2 PE=2 SV=2 37 256 5.0E-52
sp|Q99PM9|UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus GN=Uck2 PE=1 SV=1 37 256 5.0E-52
sp|Q7SYM0|UCK2A_DANRE Uridine-cytidine kinase 2-A OS=Danio rerio GN=uck2a PE=2 SV=1 47 256 9.0E-52
sp|B1H116|UCK2_XENTR Uridine-cytidine kinase 2 OS=Xenopus tropicalis GN=uck2 PE=2 SV=1 55 274 2.0E-51
sp|Q6GPD9|UCK1B_XENLA Uridine-cytidine kinase 1-B OS=Xenopus laevis GN=uck1-b PE=2 SV=1 58 256 6.0E-48
sp|Q6PA79|UCK1A_XENLA Uridine-cytidine kinase 1-A OS=Xenopus laevis GN=uck1-a PE=2 SV=1 58 256 8.0E-48
sp|Q0P5A4|UCK1_BOVIN Uridine-cytidine kinase 1 OS=Bos taurus GN=UCK1 PE=2 SV=1 58 276 5.0E-46
sp|Q9HA47|UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens GN=UCK1 PE=1 SV=1 58 256 7.0E-46
sp|Q9VC99|UCK_DROME Probable uridine-cytidine kinase OS=Drosophila melanogaster GN=CG6364 PE=3 SV=1 58 255 2.0E-45
sp|P52623|UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus GN=Uck1 PE=1 SV=2 58 256 3.0E-45
sp|Q74KI9|URK_LACJO Uridine kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=udk PE=3 SV=1 70 256 4.0E-45
sp|Q66I71|UCK1_DANRE Uridine-cytidine kinase 1 OS=Danio rerio GN=uck1 PE=2 SV=1 58 256 9.0E-45
sp|Q9KDD8|URK_BACHD Uridine kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=udk PE=3 SV=1 58 263 6.0E-43
sp|C0ZAS6|URK_BREBN Uridine kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=udk PE=3 SV=1 54 266 9.0E-43
sp|C5D4Y5|URK_GEOSW Uridine kinase OS=Geobacillus sp. (strain WCH70) GN=udk PE=3 SV=1 59 263 3.0E-42
sp|Q55GQ6|UPP_DICDI Uracil phosphoribosyltransferase OS=Dictyostelium discoideum GN=uprt PE=3 SV=1 294 527 3.0E-42
sp|Q38VV6|URK_LACSS Uridine kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=udk PE=3 SV=1 58 256 2.0E-41
sp|B9LED5|URK_CHLSY Uridine kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=udk PE=3 SV=1 58 260 3.0E-41
sp|A9WCC8|URK_CHLAA Uridine kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=udk PE=3 SV=1 58 260 3.0E-41
sp|Q1WTY6|URK_LACS1 Uridine kinase OS=Lactobacillus salivarius (strain UCC118) GN=udk PE=3 SV=1 59 263 4.0E-41
sp|A8YU29|URK_LACH4 Uridine kinase OS=Lactobacillus helveticus (strain DPC 4571) GN=udk PE=3 SV=1 70 261 1.0E-40
sp|B8G8N0|URK_CHLAD Uridine kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=udk PE=3 SV=1 59 260 2.0E-40
sp|B7GIU0|URK_ANOFW Uridine kinase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=udk PE=3 SV=1 59 263 2.0E-40
sp|Q5SKR5|URK_THET8 Uridine kinase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=udk PE=1 SV=1 58 250 4.0E-40
sp|Q72L53|URK_THET2 Uridine kinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=udk PE=3 SV=1 58 250 4.0E-40
sp|Q8EPT5|URK_OCEIH Uridine kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=udk PE=3 SV=1 59 259 5.0E-40
sp|Q12MJ0|URK_SHEDO Uridine kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=udk PE=3 SV=1 59 259 7.0E-40
sp|Q9RXZ5|URK_DEIRA Uridine kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=udk PE=3 SV=1 55 260 1.0E-39
sp|B6EIY7|URK_ALISL Uridine kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=udk PE=3 SV=1 58 260 1.0E-39
sp|B5FG51|URK_VIBFM Uridine kinase OS=Vibrio fischeri (strain MJ11) GN=udk PE=3 SV=1 57 260 2.0E-39
sp|Q5E3Z9|URK_VIBF1 Uridine kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=udk PE=3 SV=1 57 260 2.0E-39
sp|A9L4F4|URK_SHEB9 Uridine kinase OS=Shewanella baltica (strain OS195) GN=udk PE=3 SV=1 59 259 2.0E-39
sp|A6WP54|URK_SHEB8 Uridine kinase OS=Shewanella baltica (strain OS185) GN=udk PE=3 SV=1 59 259 2.0E-39
sp|B8E960|URK_SHEB2 Uridine kinase OS=Shewanella baltica (strain OS223) GN=udk PE=3 SV=1 59 259 2.0E-39
sp|C1CXN1|URK_DEIDV Uridine kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=udk PE=3 SV=1 58 256 4.0E-39
sp|A3D5E3|URK_SHEB5 Uridine kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=udk PE=3 SV=1 59 259 5.0E-39
sp|Q26998|UPP_TOXGO Uracil phosphoribosyltransferase OS=Toxoplasma gondii GN=uprt PE=1 SV=1 294 527 6.0E-39
sp|A5H0J4|UPP_LACKL Uracil phosphoribosyltransferase OS=Lachancea kluyveri GN=FUR1 PE=3 SV=1 294 527 7.0E-39
sp|B1MXP1|URK_LEUCK Uridine kinase OS=Leuconostoc citreum (strain KM20) GN=udk PE=3 SV=1 70 261 8.0E-39
sp|Q0HVY0|URK_SHESR Uridine kinase OS=Shewanella sp. (strain MR-7) GN=udk PE=3 SV=1 59 259 8.0E-39
sp|Q0HJN4|URK_SHESM Uridine kinase OS=Shewanella sp. (strain MR-4) GN=udk PE=3 SV=1 59 259 8.0E-39
sp|A0KW26|URK_SHESA Uridine kinase OS=Shewanella sp. (strain ANA-3) GN=udk PE=3 SV=1 59 259 8.0E-39
sp|Q8EDX4|URK_SHEON Uridine kinase OS=Shewanella oneidensis (strain MR-1) GN=udk PE=3 SV=1 59 259 8.0E-39
sp|A1S796|URK_SHEAM Uridine kinase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=udk PE=3 SV=1 59 259 9.0E-39
sp|B9E6Y9|URK_MACCJ Uridine kinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=udk PE=3 SV=1 70 260 2.0E-38
sp|Q896E3|URK_CLOTE Uridine kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=udk PE=3 SV=1 70 261 2.0E-38
sp|A8AWT2|URK_STRGC Uridine kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=udk PE=3 SV=1 81 264 2.0E-38
sp|A8H3V4|URK_SHEPA Uridine kinase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=udk PE=3 SV=1 56 259 2.0E-38
sp|A1SUY9|URK_PSYIN Uridine kinase OS=Psychromonas ingrahamii (strain 37) GN=udk PE=3 SV=1 56 256 2.0E-38
sp|A7MHG8|URK_CROS8 Uridine kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=udk PE=3 SV=1 59 251 5.0E-38
sp|Q4L6V8|URK_STAHJ Uridine kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=udk PE=3 SV=1 70 256 6.0E-38
sp|Q8CSB2|URK_STAES Uridine kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=udk PE=3 SV=1 70 256 6.0E-38
sp|Q5HNT9|URK_STAEQ Uridine kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=udk PE=3 SV=1 70 256 6.0E-38
sp|A1RIY2|URK_SHESW Uridine kinase OS=Shewanella sp. (strain W3-18-1) GN=udk PE=3 SV=1 59 259 7.0E-38
sp|A4Y7K6|URK_SHEPC Uridine kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=udk PE=3 SV=1 59 259 7.0E-38
sp|Q081H5|URK_SHEFN Uridine kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=udk PE=3 SV=1 59 259 8.0E-38
sp|Q8XJI6|URK_CLOPE Uridine kinase OS=Clostridium perfringens (strain 13 / Type A) GN=udk PE=3 SV=1 70 259 3.0E-37
sp|Q0TPI4|URK_CLOP1 Uridine kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=udk PE=3 SV=1 70 259 3.0E-37
sp|O13867|UPP1_SCHPO Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.01c PE=3 SV=1 287 527 3.0E-37
sp|P44533|URK_HAEIN Uridine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=udk PE=3 SV=1 57 262 4.0E-37
sp|A5UFT8|URK_HAEIG Uridine kinase OS=Haemophilus influenzae (strain PittGG) GN=udk PE=3 SV=1 57 262 4.0E-37
sp|Q4QP55|URK_HAEI8 Uridine kinase OS=Haemophilus influenzae (strain 86-028NP) GN=udk PE=3 SV=1 57 262 4.0E-37
sp|P67408|URK_SALTY Uridine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|P67409|URK_SALTI Uridine kinase OS=Salmonella typhi GN=udk PE=3 SV=1 59 251 4.0E-37
sp|B4TNH9|URK_SALSV Uridine kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|C0Q1G0|URK_SALPC Uridine kinase OS=Salmonella paratyphi C (strain RKS4594) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|A9N7M0|URK_SALPB Uridine kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|B4T9T4|URK_SALHS Uridine kinase OS=Salmonella heidelberg (strain SL476) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|B5RBW3|URK_SALG2 Uridine kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|B5R0B5|URK_SALEP Uridine kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|B5FMU1|URK_SALDC Uridine kinase OS=Salmonella dublin (strain CT_02021853) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|Q57MN1|URK_SALCH Uridine kinase OS=Salmonella choleraesuis (strain SC-B67) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|B5EXV0|URK_SALA4 Uridine kinase OS=Salmonella agona (strain SL483) GN=udk PE=3 SV=1 59 251 4.0E-37
sp|B5BF73|URK_SALPK Uridine kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=udk PE=3 SV=1 59 251 5.0E-37
sp|Q5PDX6|URK_SALPA Uridine kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=udk PE=3 SV=1 59 251 5.0E-37
sp|B2VFR1|URK_ERWT9 Uridine kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=udk PE=3 SV=1 59 268 5.0E-37
sp|B9DNJ4|URK_STACT Uridine kinase OS=Staphylococcus carnosus (strain TM300) GN=udk PE=3 SV=1 70 256 5.0E-37
sp|A0KKF8|URK_AERHH Uridine kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=udk PE=3 SV=1 59 259 6.0E-37
sp|Q0SS52|URK_CLOPS Uridine kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=udk PE=3 SV=1 70 259 6.0E-37
sp|A1JTX4|URK_YERE8 Uridine kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=udk PE=3 SV=1 59 251 6.0E-37
sp|P18562|UPP_YEAST Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR1 PE=1 SV=2 294 527 7.0E-37
sp|Q88WR0|URK_LACPL Uridine kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=udk PE=3 SV=1 59 256 8.0E-37
sp|C1CR90|URK_STRZT Uridine kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|C1CKV4|URK_STRZP Uridine kinase OS=Streptococcus pneumoniae (strain P1031) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|C1CEH1|URK_STRZJ Uridine kinase OS=Streptococcus pneumoniae (strain JJA) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|P67414|URK_STRR6 Uridine kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|B2IPS2|URK_STRPS Uridine kinase OS=Streptococcus pneumoniae (strain CGSP14) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|P67413|URK_STRPN Uridine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|B8ZQ77|URK_STRPJ Uridine kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|B1IC10|URK_STRPI Uridine kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|C1C7H7|URK_STRP7 Uridine kinase OS=Streptococcus pneumoniae (strain 70585) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|Q04KA9|URK_STRP2 Uridine kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=udk PE=3 SV=1 89 264 8.0E-37
sp|B1JPY6|URK_YERPY Uridine kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=udk PE=3 SV=1 59 251 9.0E-37
sp|Q66C70|URK_YERPS Uridine kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=udk PE=3 SV=1 59 251 9.0E-37
sp|A4TKM7|URK_YERPP Uridine kinase OS=Yersinia pestis (strain Pestoides F) GN=udk PE=3 SV=1 59 251 9.0E-37
sp|Q1CGU6|URK_YERPN Uridine kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=udk PE=3 SV=1 59 251 9.0E-37
sp|A9R2M5|URK_YERPG Uridine kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=udk PE=3 SV=1 59 251 9.0E-37
sp|Q8ZFZ9|URK_YERPE Uridine kinase OS=Yersinia pestis GN=udk PE=3 SV=1 59 251 9.0E-37
sp|B2JZK5|URK_YERPB Uridine kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=udk PE=3 SV=1 59 251 9.0E-37
sp|Q1C9T6|URK_YERPA Uridine kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=udk PE=3 SV=1 59 251 9.0E-37
sp|A7FJJ4|URK_YERP3 Uridine kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=udk PE=3 SV=1 59 251 9.0E-37
sp|B0TJ03|URK_SHEHH Uridine kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=udk PE=3 SV=1 56 259 9.0E-37
sp|P67412|URK_STAAW Uridine kinase OS=Staphylococcus aureus (strain MW2) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|A8Z4E9|URK_STAAT Uridine kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|Q6G8V8|URK_STAAS Uridine kinase OS=Staphylococcus aureus (strain MSSA476) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|Q6GG92|URK_STAAR Uridine kinase OS=Staphylococcus aureus (strain MRSA252) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|P67411|URK_STAAN Uridine kinase OS=Staphylococcus aureus (strain N315) GN=udk PE=1 SV=1 70 256 1.0E-36
sp|P67410|URK_STAAM Uridine kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|A6QHF2|URK_STAAE Uridine kinase OS=Staphylococcus aureus (strain Newman) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|Q5HFF1|URK_STAAC Uridine kinase OS=Staphylococcus aureus (strain COL) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|Q2YT67|URK_STAAB Uridine kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|A5ITD6|URK_STAA9 Uridine kinase OS=Staphylococcus aureus (strain JH9) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|Q2FXW6|URK_STAA8 Uridine kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|Q2FGB5|URK_STAA3 Uridine kinase OS=Staphylococcus aureus (strain USA300) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|A6U280|URK_STAA2 Uridine kinase OS=Staphylococcus aureus (strain JH1) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|A7X320|URK_STAA1 Uridine kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=udk PE=3 SV=1 70 256 1.0E-36
sp|B2G882|URK_LACRJ Uridine kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=udk PE=3 SV=1 59 262 1.0E-36
sp|A5VKU8|URK_LACRD Uridine kinase OS=Lactobacillus reuteri (strain DSM 20016) GN=udk PE=3 SV=1 59 262 1.0E-36
sp|B4SXV3|URK_SALNS Uridine kinase OS=Salmonella newport (strain SL254) GN=udk PE=3 SV=1 59 251 2.0E-36
sp|Q8DTG1|URK_STRMU Uridine kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=udk PE=3 SV=1 58 261 2.0E-36
sp|B1IJ68|URK_CLOBK Uridine kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=udk PE=3 SV=1 70 261 2.0E-36
sp|P0A8F7|URK_SHIFL Uridine kinase OS=Shigella flexneri GN=udk PE=3 SV=1 59 251 2.0E-36
sp|P0A8F4|URK_ECOLI Uridine kinase OS=Escherichia coli (strain K12) GN=udk PE=3 SV=1 59 251 2.0E-36
sp|P0A8F5|URK_ECOL6 Uridine kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=udk PE=3 SV=1 59 251 2.0E-36
sp|P0A8F6|URK_ECO57 Uridine kinase OS=Escherichia coli O157:H7 GN=udk PE=3 SV=1 59 251 2.0E-36
sp|B7LV30|URK_ESCF3 Uridine kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=udk PE=3 SV=1 59 251 2.0E-36
sp|Q6HDE5|URK_BACHK Uridine kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=udk PE=3 SV=1 86 264 3.0E-36
sp|Q634G4|URK_BACCZ Uridine kinase OS=Bacillus cereus (strain ZK / E33L) GN=udk PE=3 SV=1 86 264 3.0E-36
sp|C1ESS5|URK_BACC3 Uridine kinase OS=Bacillus cereus (strain 03BB102) GN=udk PE=3 SV=1 86 264 3.0E-36
sp|B7JP70|URK_BACC0 Uridine kinase OS=Bacillus cereus (strain AH820) GN=udk PE=3 SV=1 86 264 3.0E-36
sp|A0RIZ3|URK_BACAH Uridine kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=udk PE=3 SV=1 86 264 3.0E-36
sp|C1FSX6|URK_CLOBJ Uridine kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=udk PE=3 SV=1 70 261 3.0E-36
sp|B1KXA7|URK_CLOBM Uridine kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=udk PE=3 SV=1 70 261 5.0E-36
sp|B4ESY8|URK_PROMH Uridine kinase OS=Proteus mirabilis (strain HI4320) GN=udk PE=3 SV=1 59 251 5.0E-36
sp|B9IYE5|URK_BACCQ Uridine kinase OS=Bacillus cereus (strain Q1) GN=udk PE=3 SV=1 86 264 6.0E-36
sp|B7HQD8|URK_BACC7 Uridine kinase OS=Bacillus cereus (strain AH187) GN=udk PE=3 SV=1 86 264 6.0E-36
sp|Q730F4|URK_BACC1 Uridine kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=udk PE=3 SV=1 86 264 6.0E-36
sp|C6DCI6|URK_PECCP Uridine kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=udk PE=3 SV=1 59 251 6.0E-36
sp|A7MVE7|URK_VIBCB Uridine kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=udk PE=3 SV=1 57 260 7.0E-36
sp|Q6D7B4|URK_PECAS Uridine kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=udk PE=3 SV=1 59 251 7.0E-36
sp|Q817Z5|URK_BACCR Uridine kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=udk PE=3 SV=1 86 264 7.0E-36
sp|B7HE15|URK_BACC4 Uridine kinase OS=Bacillus cereus (strain B4264) GN=udk PE=3 SV=1 86 264 7.0E-36
sp|A4IR72|URK_GEOTN Uridine kinase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=udk PE=3 SV=1 59 263 8.0E-36
sp|B7IYN4|URK_BACC2 Uridine kinase OS=Bacillus cereus (strain G9842) GN=udk PE=3 SV=1 86 264 9.0E-36
sp|A8GC40|URK_SERP5 Uridine kinase OS=Serratia proteamaculans (strain 568) GN=udk PE=3 SV=1 59 251 9.0E-36
sp|Q81LK8|URK_BACAN Uridine kinase OS=Bacillus anthracis GN=udk PE=3 SV=1 86 264 1.0E-35
sp|C3L5Y6|URK_BACAC Uridine kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=udk PE=3 SV=1 86 264 1.0E-35
sp|C3P969|URK_BACAA Uridine kinase OS=Bacillus anthracis (strain A0248) GN=udk PE=3 SV=1 86 264 1.0E-35
sp|B8CPI6|URK_SHEPW Uridine kinase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=udk PE=3 SV=1 59 259 1.0E-35
sp|A6TBG6|URK_KLEP7 Uridine kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=udk PE=3 SV=1 59 251 2.0E-35
sp|B5XPC8|URK_KLEP3 Uridine kinase OS=Klebsiella pneumoniae (strain 342) GN=udk PE=3 SV=1 59 251 2.0E-35
sp|C3L140|URK_CLOB6 Uridine kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=udk PE=3 SV=1 70 261 2.0E-35
sp|A4WCB6|URK_ENT38 Uridine kinase OS=Enterobacter sp. (strain 638) GN=udk PE=3 SV=1 59 251 2.0E-35
sp|A7GGE1|URK_CLOBL Uridine kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=udk PE=3 SV=1 70 261 2.0E-35
sp|Q65GT3|URK_BACLD Uridine kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=udk PE=3 SV=1 70 263 2.0E-35
sp|A7GT59|URK_BACCN Uridine kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=udk PE=3 SV=1 86 264 3.0E-35
sp|Q2NUC7|URK_SODGM Uridine kinase OS=Sodalis glossinidius (strain morsitans) GN=udk PE=3 SV=1 59 251 4.0E-35
sp|A4SML3|URK_AERS4 Uridine kinase OS=Aeromonas salmonicida (strain A449) GN=udk PE=3 SV=1 59 251 5.0E-35
sp|Q9HQC9|URK_HALSA Uridine kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=udk PE=3 SV=2 70 261 5.0E-35
sp|Q5KWV3|URK_GEOKA Uridine kinase OS=Geobacillus kaustophilus (strain HTA426) GN=udk PE=3 SV=1 59 263 5.0E-35
sp|A9VI01|URK_BACWK Uridine kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=udk PE=3 SV=1 86 264 8.0E-35
sp|A8FFL8|URK_BACP2 Uridine kinase OS=Bacillus pumilus (strain SAFR-032) GN=udk PE=3 SV=1 86 263 8.0E-35
sp|A0Q140|URK_CLONN Uridine kinase OS=Clostridium novyi (strain NT) GN=udk PE=3 SV=1 70 263 1.0E-34
sp|Q49Y49|URK_STAS1 Uridine kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=udk PE=3 SV=1 70 256 1.0E-34
sp|Q7MM12|URK_VIBVY Uridine kinase OS=Vibrio vulnificus (strain YJ016) GN=udk PE=3 SV=2 57 260 2.0E-34
sp|Q8D8F4|URK_VIBVU Uridine kinase OS=Vibrio vulnificus (strain CMCP6) GN=udk PE=3 SV=1 57 260 2.0E-34
sp|B7VLX0|URK_VIBTL Uridine kinase OS=Vibrio tasmaniensis (strain LGP32) GN=udk PE=3 SV=1 57 260 2.0E-34
sp|Q92BL6|URK_LISIN Uridine kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=udk PE=3 SV=1 86 261 5.0E-34
sp|Q4R4K2|UCK1_MACFA Uridine-cytidine kinase 1 OS=Macaca fascicularis GN=UCK1 PE=2 SV=1 58 256 7.0E-34
sp|Q9KT67|URK_VIBCH Uridine kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=udk PE=3 SV=2 57 260 7.0E-34
sp|A0AIU6|URK_LISW6 Uridine kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=udk PE=3 SV=1 86 261 7.0E-34
sp|Q8Y727|URK_LISMO Uridine kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=udk PE=3 SV=1 70 261 8.0E-34
sp|Q02XK6|URK_LACLS Uridine kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=udk PE=3 SV=1 57 261 8.0E-34
sp|A2RJB4|URK_LACLM Uridine kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=udk PE=3 SV=1 57 261 8.0E-34
sp|C4LEX3|URK_TOLAT Uridine kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=udk PE=3 SV=1 56 259 1.0E-33
sp|B8DE13|URK_LISMH Uridine kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=udk PE=3 SV=1 86 261 1.0E-33
sp|Q71ZH3|URK_LISMF Uridine kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=udk PE=3 SV=1 86 261 1.0E-33
sp|C1KVE4|URK_LISMC Uridine kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=udk PE=3 SV=1 86 261 1.0E-33
sp|Q9CF21|URK_LACLA Uridine kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=udk PE=3 SV=1 57 261 1.0E-33
sp|Q7N6J4|URK_PHOLL Uridine kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=udk PE=3 SV=1 59 251 2.0E-33
sp|Q87N09|URK_VIBPA Uridine kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=udk PE=3 SV=1 57 260 2.0E-33
sp|Q9Z7H0|URK_CHLPN Uridine kinase OS=Chlamydia pneumoniae GN=udk PE=3 SV=1 61 260 3.0E-33
sp|Q9CM85|URK_PASMU Uridine kinase OS=Pasteurella multocida (strain Pm70) GN=udk PE=3 SV=1 71 262 4.0E-33
sp|Q9PQF9|URK_UREPA Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=udk PE=3 SV=1 58 251 1.0E-32
sp|B1AIX1|URK_UREP2 Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=udk PE=3 SV=1 58 251 1.0E-32
sp|A6TR08|URK_ALKMQ Uridine kinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=udk PE=3 SV=1 70 263 2.0E-32
sp|A5UB17|URK_HAEIE Uridine kinase OS=Haemophilus influenzae (strain PittEE) GN=udk PE=3 SV=1 73 262 2.0E-32
sp|Q65S71|URK_MANSM Uridine kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=udk PE=3 SV=1 73 255 2.0E-32
sp|B5ZBE2|URK_UREU1 Uridine kinase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=udk PE=3 SV=1 58 251 3.0E-32
sp|Q662Z7|URK_BORBP Uridine kinase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=udk PE=3 SV=1 84 261 3.0E-32
sp|B5E4U6|URK_STRP4 Uridine kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=udk PE=3 SV=1 89 264 4.0E-32
sp|Q0SPE9|URK_BORAP Uridine kinase OS=Borrelia afzelii (strain PKo) GN=udk PE=3 SV=1 84 261 6.0E-32
sp|B0UT65|URK_HISS2 Uridine kinase OS=Histophilus somni (strain 2336) GN=udk PE=3 SV=1 73 262 9.0E-32
sp|Q0I2Y9|URK_HAES1 Uridine kinase OS=Haemophilus somnus (strain 129Pt) GN=udk PE=3 SV=1 73 262 9.0E-32
sp|B5RQJ8|URK_BORRA Uridine kinase OS=Borrelia recurrentis (strain A1) GN=udk PE=3 SV=1 84 266 1.0E-31
sp|B5RLM3|URK_BORDL Uridine kinase OS=Borrelia duttonii (strain Ly) GN=udk PE=3 SV=1 84 266 1.0E-31
sp|A1QYG8|URK_BORT9 Uridine kinase OS=Borrelia turicatae (strain 91E135) GN=udk PE=3 SV=1 84 263 3.0E-31
sp|B2S1K4|URK_BORHD Uridine kinase OS=Borrelia hermsii (strain HS1 / DAH) GN=udk PE=3 SV=1 84 266 2.0E-30
sp|O32033|URK_BACSU Uridine kinase OS=Bacillus subtilis (strain 168) GN=udk PE=3 SV=1 70 263 5.0E-30
sp|Q6NYU7|UPP_DANRE Uracil phosphoribosyltransferase homolog OS=Danio rerio GN=uprt PE=2 SV=1 282 486 1.0E-29
sp|B7J0V4|URK_BORBZ Uridine kinase OS=Borrelia burgdorferi (strain ZS7) GN=udk PE=3 SV=1 84 261 3.0E-29
sp|Q59190|URK_BORBU Uridine kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=udk PE=1 SV=3 84 261 3.0E-29
sp|Q17413|UCK_CAEEL Probable uridine-cytidine kinase OS=Caenorhabditis elegans GN=B0001.4 PE=3 SV=2 58 261 3.0E-29
sp|A7Z727|URK_BACMF Uridine kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=udk PE=3 SV=1 70 263 1.0E-28
sp|Q03K46|URK_STRTD Uridine kinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=udk PE=3 SV=1 87 261 2.0E-28
sp|Q5M3V0|URK_STRT2 Uridine kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=udk PE=3 SV=1 87 261 2.0E-28
sp|Q5LZ98|URK_STRT1 Uridine kinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=udk PE=3 SV=1 87 261 2.0E-28
sp|P47622|URK_MYCGE Uridine kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=udk PE=3 SV=1 57 264 6.0E-28
sp|C0MCM8|URK_STRS7 Uridine kinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=udk PE=3 SV=1 81 255 7.0E-28
sp|B4U220|URK_STREM Uridine kinase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=udk PE=3 SV=1 81 255 7.0E-28
sp|C0M9M0|URK_STRE4 Uridine kinase OS=Streptococcus equi subsp. equi (strain 4047) GN=udk PE=3 SV=1 81 255 7.0E-28
sp|P75217|URK_MYCPN Uridine kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=udk PE=3 SV=1 59 240 2.0E-27
sp|Q5ZIJ8|UPP_CHICK Uracil phosphoribosyltransferase homolog OS=Gallus gallus GN=UPRT PE=2 SV=1 289 486 3.0E-27
sp|Q8E0A8|URK_STRA5 Uridine kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=udk PE=3 SV=1 87 261 1.0E-26
sp|Q3K1N1|URK_STRA1 Uridine kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=udk PE=3 SV=1 87 261 1.0E-26
sp|Q8E5Y5|URK_STRA3 Uridine kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=udk PE=3 SV=1 87 261 1.0E-26
sp|B5XM21|URK_STRPZ Uridine kinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=udk PE=3 SV=1 81 261 2.0E-26
sp|P0DH37|URK_STRPQ Uridine kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=udk PE=3 SV=1 81 261 2.0E-26
sp|A2RDZ9|URK_STRPG Uridine kinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=udk PE=3 SV=1 81 261 2.0E-26
sp|Q5XBI8|URK_STRP6 Uridine kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=udk PE=1 SV=2 81 261 2.0E-26
sp|P0DH36|URK_STRP3 Uridine kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=udk PE=3 SV=1 81 261 2.0E-26
sp|P67415|URK_STRP1 Uridine kinase OS=Streptococcus pyogenes serotype M1 GN=udk PE=3 SV=1 81 261 2.0E-26
sp|Q8P0F8|URK_STRP8 Uridine kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=udk PE=3 SV=1 81 261 2.0E-26
sp|B1AVZ0|UPP_MOUSE Uracil phosphoribosyltransferase homolog OS=Mus musculus GN=Uprt PE=1 SV=1 295 486 2.0E-26
sp|Q32LA4|UPP_BOVIN Uracil phosphoribosyltransferase homolog OS=Bos taurus GN=UPRT PE=2 SV=1 295 486 3.0E-26
sp|Q7VL27|URK_HAEDU Uridine kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=udk PE=3 SV=1 45 262 3.0E-26
sp|B9DSN2|URK_STRU0 Uridine kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=udk PE=3 SV=1 81 261 3.0E-26
sp|Q96BW1|UPP_HUMAN Uracil phosphoribosyltransferase homolog OS=Homo sapiens GN=UPRT PE=1 SV=1 295 486 5.0E-26
sp|Q95KB0|UPP_MACFA Uracil phosphoribosyltransferase homolog OS=Macaca fascicularis GN=UPRT PE=2 SV=1 295 486 8.0E-26
sp|Q9HE15|UPP2_SCHPO Uracil phosphoribosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.04c PE=3 SV=1 284 527 1.0E-22
sp|Q03EK5|UPP_PEDPA Uracil phosphoribosyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=upp PE=3 SV=1 304 527 9.0E-16
sp|Q03QY1|UPP_LACBA Uracil phosphoribosyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=upp PE=3 SV=1 304 527 6.0E-15
sp|B8E009|UPP_DICTD Uracil phosphoribosyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=upp PE=3 SV=1 304 527 7.0E-15
sp|Q9CEC9|UPP_LACLA Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=upp PE=3 SV=1 304 527 2.0E-14
sp|B5YDB8|UPP_DICT6 Uracil phosphoribosyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=upp PE=3 SV=1 304 527 2.0E-14
sp|P50926|UPP_LACLM Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=upp PE=3 SV=1 304 527 4.0E-14
sp|Q02WM7|UPP_LACLS Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=upp PE=3 SV=1 304 527 6.0E-14
sp|B2GAT5|UPP_LACF3 Uracil phosphoribosyltransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=upp PE=3 SV=1 304 527 6.0E-14
sp|Q9RE01|UPP_LACPL Uracil phosphoribosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=upp PE=3 SV=1 304 527 9.0E-14
sp|B2G680|UPP_LACRJ Uracil phosphoribosyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=upp PE=3 SV=1 304 527 1.0E-13
sp|A5VIQ0|UPP_LACRD Uracil phosphoribosyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=upp PE=3 SV=1 304 527 1.0E-13
sp|Q1WUD3|UPP_LACS1 Uracil phosphoribosyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=upp PE=3 SV=1 304 527 1.0E-13
sp|A7ZFB7|UPP_CAMC1 Uracil phosphoribosyltransferase OS=Campylobacter concisus (strain 13826) GN=upp PE=3 SV=1 308 527 2.0E-13
sp|Q9K6G5|UPP_BACHD Uracil phosphoribosyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=upp PE=3 SV=1 304 527 5.0E-13
sp|B2U8Z0|UPP_RALPJ Uracil phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=upp PE=3 SV=1 294 527 1.0E-12
sp|B3PM96|UPP_MYCA5 Uracil phosphoribosyltransferase OS=Mycoplasma arthritidis (strain 158L3-1) GN=upp PE=3 SV=1 308 527 1.0E-12
sp|B3WDL1|UPP_LACCB Uracil phosphoribosyltransferase OS=Lactobacillus casei (strain BL23) GN=upp PE=3 SV=1 295 527 2.0E-12
sp|Q03A25|UPP_LACC3 Uracil phosphoribosyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=upp PE=3 SV=1 295 527 2.0E-12
sp|A3DIL9|UPP_CLOTH Uracil phosphoribosyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=upp PE=3 SV=1 304 527 2.0E-12
sp|Q8EM74|UPP_OCEIH Uracil phosphoribosyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=upp PE=3 SV=1 304 527 3.0E-12
sp|Q38WJ8|UPP_LACSS Uracil phosphoribosyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=upp PE=3 SV=1 295 527 3.0E-12
sp|Q93CX7|UPP_LACSK Uracil phosphoribosyltransferase OS=Lactobacillus sakei GN=upp PE=3 SV=1 295 527 3.0E-12
sp|Q03M79|UPP_STRTD Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=upp PE=3 SV=1 304 527 4.0E-12
sp|Q5M5U5|UPP_STRT2 Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=upp PE=3 SV=1 304 527 4.0E-12
sp|Q5M1A9|UPP_STRT1 Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=upp PE=3 SV=1 304 527 4.0E-12
sp|A4VWM9|UPP_STRSY Uracil phosphoribosyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=upp PE=3 SV=1 304 527 4.0E-12
sp|Q8XXC7|UPP_RALSO Uracil phosphoribosyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=upp PE=3 SV=1 300 527 4.0E-12
sp|Q54R62|UCKC_DICDI Uridine-cytidine kinase C OS=Dictyostelium discoideum GN=udkC PE=3 SV=1 55 243 5.0E-12
sp|A9KIB0|UPP_CLOPH Uracil phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=upp PE=3 SV=1 304 527 7.0E-12
sp|B8I567|UPP_CLOCE Uracil phosphoribosyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=upp PE=3 SV=1 304 527 9.0E-12
sp|P67399|UPP_STRA5 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=upp PE=3 SV=1 304 527 9.0E-12
sp|P67398|UPP_STRA3 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=upp PE=3 SV=1 304 527 9.0E-12
sp|Q3JZU9|UPP_STRA1 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=upp PE=3 SV=1 304 527 9.0E-12
sp|P36399|UPP_STRSL Uracil phosphoribosyltransferase OS=Streptococcus salivarius GN=upp PE=3 SV=1 304 527 1.0E-11
sp|Q927V5|UPP_LISIN Uracil phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=upp PE=3 SV=1 300 527 2.0E-11
sp|Q5WB67|UPP_BACSK Uracil phosphoribosyltransferase OS=Bacillus clausii (strain KSM-K16) GN=upp PE=3 SV=1 304 527 2.0E-11
sp|Q042K8|UPP_LACGA Uracil phosphoribosyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=upp PE=3 SV=1 295 527 3.0E-11
sp|A0ALM3|UPP_LISW6 Uracil phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=upp PE=3 SV=1 300 527 3.0E-11
sp|Q8Y4B3|UPP_LISMO Uracil phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=upp PE=3 SV=1 300 527 3.0E-11
sp|B8DBH1|UPP_LISMH Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=upp PE=3 SV=1 300 527 3.0E-11
sp|Q71WP0|UPP_LISMF Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=upp PE=3 SV=1 300 527 3.0E-11
sp|C1KYV5|UPP_LISMC Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=upp PE=3 SV=1 300 527 3.0E-11
sp|B0S2A9|UPP_FINM2 Uracil phosphoribosyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=upp PE=3 SV=1 308 527 4.0E-11
sp|Q831G0|UPP_ENTFA Uracil phosphoribosyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=upp PE=3 SV=1 304 527 4.0E-11
sp|B1L7Y5|UPP_THESQ Uracil phosphoribosyltransferase OS=Thermotoga sp. (strain RQ2) GN=upp PE=3 SV=1 308 527 4.0E-11
sp|A5IJ64|UPP_THEP1 Uracil phosphoribosyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=upp PE=3 SV=1 308 527 4.0E-11
sp|A6TK51|UPP_ALKMQ Uracil phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=upp PE=3 SV=1 304 527 4.0E-11
sp|A3CPK9|UPP_STRSV Uracil phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=upp PE=3 SV=1 304 527 5.0E-11
sp|A8AYQ0|UPP_STRGC Uracil phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=upp PE=3 SV=1 304 527 5.0E-11
sp|B9DTU7|UPP_STRU0 Uracil phosphoribosyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=upp PE=3 SV=1 304 527 6.0E-11
sp|Q9WZI0|UPP_THEMA Uracil phosphoribosyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=upp PE=1 SV=1 308 527 6.0E-11
sp|Q04DP1|UPP_OENOB Uracil phosphoribosyltransferase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=upp PE=3 SV=1 300 527 8.0E-11
sp|Q97RQ3|UPP_STRPN Uracil phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=upp PE=3 SV=1 300 527 1.0E-10
sp|P37101|KPPR_SYNY3 Phosphoribulokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prk PE=2 SV=1 59 239 1.0E-10
sp|P0DH35|UPP_STRPQ Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|Q48V26|UPP_STRPM Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|A2RG73|UPP_STRPG Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|Q1J888|UPP_STRPF Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|Q1JID6|UPP_STRPD Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|Q1JN85|UPP_STRPC Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|P67402|UPP_STRP8 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|Q5XDM5|UPP_STRP6 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|P0DH34|UPP_STRP3 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|P67400|UPP_STRP1 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M1 GN=upp PE=3 SV=1 304 527 1.0E-10
sp|Q8DQI3|UPP_STRR6 Uracil phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=upp PE=3 SV=2 300 527 1.0E-10
sp|C0MGT4|UPP_STRS7 Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|B4U4M9|UPP_STREM Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|C0M7M9|UPP_STRE4 Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=upp PE=3 SV=1 304 527 1.0E-10
sp|C4KYT2|UPP_EXISA Uracil phosphoribosyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=upp PE=3 SV=1 304 527 2.0E-10
sp|C4Z9S1|UPP_EUBR3 Uracil phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=upp PE=3 SV=1 304 527 2.0E-10
sp|Q8DST6|UPP_STRMU Uracil phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=upp PE=3 SV=1 304 527 2.0E-10
sp|B5XJZ7|UPP_STRPZ Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=upp PE=3 SV=1 304 527 3.0E-10
sp|P09559|KPPR_SPIOL Phosphoribulokinase, chloroplastic OS=Spinacia oleracea PE=1 SV=1 59 239 4.0E-10
sp|A7H0F9|UPP_CAMC5 Uracil phosphoribosyltransferase OS=Campylobacter curvus (strain 525.92) GN=upp PE=3 SV=1 308 527 4.0E-10
sp|Q2SZS9|UPP_BURTA Uracil phosphoribosyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=upp PE=3 SV=1 304 527 4.0E-10
sp|Q9RU32|UPP_DEIRA Uracil phosphoribosyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|B2JE33|UPP_BURP8 Uracil phosphoribosyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|Q6HAX0|UPP_BACHK Uracil phosphoribosyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|Q630T4|UPP_BACCZ Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|Q814V3|UPP_BACCR Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|B9IRU7|UPP_BACCQ Uracil phosphoribosyltransferase OS=Bacillus cereus (strain Q1) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|B7HY75|UPP_BACC7 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain AH187) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|B7HFL2|UPP_BACC4 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain B4264) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|C1F0N8|UPP_BACC3 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain 03BB102) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|B7IQW8|UPP_BACC2 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain G9842) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|Q72XD8|UPP_BACC1 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|B7JGP0|UPP_BACC0 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain AH820) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|Q81JY5|UPP_BACAN Uracil phosphoribosyltransferase OS=Bacillus anthracis GN=upp PE=3 SV=1 304 527 5.0E-10
sp|C3LFI9|UPP_BACAC Uracil phosphoribosyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|C3P1G4|UPP_BACAA Uracil phosphoribosyltransferase OS=Bacillus anthracis (strain A0248) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|A9VSB3|UPP_BACWK Uracil phosphoribosyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|A0RLA2|UPP_BACAH Uracil phosphoribosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=upp PE=3 SV=1 304 527 5.0E-10
sp|Q5SIQ7|UPP_THET8 Uracil phosphoribosyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=upp PE=3 SV=1 311 527 7.0E-10
sp|Q72J35|UPP_THET2 Uracil phosphoribosyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=upp PE=1 SV=1 311 527 7.0E-10
sp|B7IDR9|UPP_THEAB Uracil phosphoribosyltransferase OS=Thermosipho africanus (strain TCF52B) GN=upp PE=3 SV=1 308 527 7.0E-10
sp|A8MJX1|UPP_ALKOO Uracil phosphoribosyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=upp PE=3 SV=1 304 527 7.0E-10
sp|A3N7G1|UPP_BURP6 Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 668) GN=upp PE=3 SV=1 304 527 7.0E-10
sp|Q1MMV8|UPP_RHIL3 Uracil phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=upp PE=3 SV=1 304 527 8.0E-10
sp|C5D9M4|UPP_GEOSW Uracil phosphoribosyltransferase OS=Geobacillus sp. (strain WCH70) GN=upp PE=3 SV=1 304 527 8.0E-10
sp|Q63VS8|UPP_BURPS Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=upp PE=1 SV=1 304 527 9.0E-10
sp|Q3JUF6|UPP_BURP1 Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=upp PE=3 SV=1 304 527 9.0E-10
sp|A3NT50|UPP_BURP0 Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=upp PE=3 SV=1 304 527 9.0E-10
sp|A1V2G4|UPP_BURMS Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain SAVP1) GN=upp PE=3 SV=1 304 527 9.0E-10
sp|Q62IJ1|UPP_BURMA Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=upp PE=3 SV=1 304 527 9.0E-10
sp|A2S4B1|UPP_BURM9 Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=upp PE=3 SV=1 304 527 9.0E-10
sp|A3MI49|UPP_BURM7 Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=upp PE=3 SV=1 304 527 9.0E-10
sp|A6LQG6|UPP_CLOB8 Uracil phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=upp PE=3 SV=1 308 527 1.0E-09
sp|B0K1G2|UPP_THEPX Uracil phosphoribosyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=upp PE=3 SV=1 304 527 1.0E-09
sp|B0K7G1|UPP_THEP3 Uracil phosphoribosyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=upp PE=3 SV=1 304 527 1.0E-09
sp|B9J6V7|UPP_AGRRK Uracil phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=upp PE=3 SV=1 304 527 1.0E-09
sp|A9AJK1|UPP_BURM1 Uracil phosphoribosyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=upp PE=3 SV=1 304 527 1.0E-09
sp|C0Z818|UPP_BREBN Uracil phosphoribosyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=upp PE=3 SV=1 304 527 1.0E-09
sp|B1JW40|UPP_BURCC Uracil phosphoribosyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=upp PE=3 SV=1 304 527 1.0E-09
sp|B1YU48|UPP_BURA4 Uracil phosphoribosyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=upp PE=3 SV=1 304 527 1.0E-09
sp|A0RR59|UPP_CAMFF Uracil phosphoribosyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=upp PE=3 SV=1 308 527 1.0E-09
sp|B4E5R5|UPP_BURCJ Uracil phosphoribosyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=upp PE=3 SV=1 304 527 2.0E-09
sp|B0TI63|UPP_HELMI Uracil phosphoribosyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=upp PE=3 SV=1 304 527 2.0E-09
sp|Q5KUI3|UPP_GEOKA Uracil phosphoribosyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=upp PE=3 SV=1 304 527 2.0E-09
sp|Q0BD86|UPP_BURCM Uracil phosphoribosyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=upp PE=3 SV=1 304 527 2.0E-09
sp|B3PXN0|UPP_RHIE6 Uracil phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=upp PE=3 SV=1 304 527 2.0E-09
sp|P70881|UPP_BACCL Uracil phosphoribosyltransferase OS=Bacillus caldolyticus GN=upp PE=1 SV=2 304 527 2.0E-09
sp|A4JGH4|UPP_BURVG Uracil phosphoribosyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=upp PE=3 SV=1 304 527 2.0E-09
sp|A8FIC0|UPP_BACP2 Uracil phosphoribosyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=upp PE=3 SV=1 304 527 2.0E-09
sp|A7GV65|UPP_BACCN Uracil phosphoribosyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=upp PE=3 SV=1 304 527 2.0E-09
sp|A1WQN5|UPP_VEREI Uracil phosphoribosyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=upp PE=3 SV=1 304 527 3.0E-09
sp|B7GMG3|UPP_ANOFW Uracil phosphoribosyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=upp PE=3 SV=1 304 527 3.0E-09
sp|B5ZXI2|UPP_RHILW Uracil phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=upp PE=3 SV=1 304 527 3.0E-09
sp|P19824|KPPR_CHLRE Phosphoribulokinase, chloroplastic OS=Chlamydomonas reinhardtii GN=PRKA PE=1 SV=1 59 239 3.0E-09
sp|Q8RD94|UPP_CALS4 Uracil phosphoribosyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=upp PE=3 SV=1 304 527 3.0E-09
sp|Q2S320|UPP_SALRD Uracil phosphoribosyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=upp PE=3 SV=1 304 527 3.0E-09
sp|Q39EA2|UPP_BURL3 Uracil phosphoribosyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=upp PE=3 SV=1 304 527 4.0E-09
sp|Q65DW6|UPP_BACLD Uracil phosphoribosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=upp PE=3 SV=1 304 527 4.0E-09
sp|A5N3J1|UPP_CLOK5 Uracil phosphoribosyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=upp PE=3 SV=1 308 527 4.0E-09
sp|B9DX75|UPP_CLOK1 Uracil phosphoribosyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=upp PE=3 SV=1 308 527 4.0E-09
sp|B1HM47|UPP_LYSSC Uracil phosphoribosyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=upp PE=3 SV=1 304 527 4.0E-09
sp|A1VN11|UPP_POLNA Uracil phosphoribosyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=upp PE=3 SV=1 304 527 4.0E-09
sp|Q6KHA6|UPP_MYCMO Uracil phosphoribosyltransferase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=upp PE=3 SV=1 308 527 5.0E-09
sp|P26302|KPPR_WHEAT Phosphoribulokinase, chloroplastic OS=Triticum aestivum PE=2 SV=1 59 239 5.0E-09
sp|Q8FUZ2|UPP_BRUSU Uracil phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=upp PE=3 SV=2 304 527 6.0E-09
sp|A9WW75|UPP_BRUSI Uracil phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=upp PE=3 SV=1 304 527 6.0E-09
sp|A9MCZ3|UPP_BRUC2 Uracil phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=upp PE=3 SV=1 304 527 6.0E-09
sp|Q8XIC4|UPP_CLOPE Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=upp PE=3 SV=1 308 527 6.0E-09
sp|Q0TNB4|UPP_CLOP1 Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=upp PE=3 SV=1 308 527 6.0E-09
sp|Q8UJ06|UPP_AGRFC Uracil phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=upp PE=3 SV=1 308 527 7.0E-09
sp|A5VVW9|UPP_BRUO2 Uracil phosphoribosyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=upp PE=3 SV=1 304 527 7.0E-09
sp|Q0SQY5|UPP_CLOPS Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=upp PE=3 SV=1 308 527 7.0E-09
sp|B9DMF2|UPP_STACT Uracil phosphoribosyltransferase OS=Staphylococcus carnosus (strain TM300) GN=upp PE=3 SV=1 304 527 8.0E-09
sp|P27774|KPPR_MESCR Phosphoribulokinase, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 53 239 9.0E-09
sp|P39149|UPP_BACSU Uracil phosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=upp PE=3 SV=1 304 527 1.0E-08
sp|Q92T49|UPP_RHIME Uracil phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=upp PE=3 SV=1 304 527 1.0E-08
sp|A7Z9Q8|UPP_BACMF Uracil phosphoribosyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=upp PE=3 SV=1 304 527 1.0E-08
sp|B9KAQ6|UPP_THENN Uracil phosphoribosyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=upp PE=3 SV=1 308 527 1.0E-08
sp|B9MJ16|UPP_ACIET Uracil phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=upp PE=3 SV=1 304 527 1.0E-08
sp|Q142L5|UPP_BURXL Uracil phosphoribosyltransferase OS=Burkholderia xenovorans (strain LB400) GN=upp PE=3 SV=1 304 527 1.0E-08
sp|B2T2A6|UPP_BURPP Uracil phosphoribosyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=upp PE=3 SV=1 304 527 1.0E-08
sp|Q04BB0|UPP_LACDB Uracil phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=upp PE=3 SV=1 295 527 1.0E-08
sp|Q1GAX2|UPP_LACDA Uracil phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=upp PE=3 SV=1 295 527 1.0E-08
sp|Q97F73|UPP_CLOAB Uracil phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=upp PE=3 SV=1 308 527 2.0E-08
sp|A1W748|UPP_ACISJ Uracil phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=upp PE=3 SV=1 304 527 2.0E-08
sp|A0Q306|UPP_CLONN Uracil phosphoribosyltransferase OS=Clostridium novyi (strain NT) GN=upp PE=3 SV=1 308 527 2.0E-08
sp|Q8YDE5|UPP_BRUME Uracil phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=upp PE=3 SV=1 304 527 2.0E-08
sp|C0RMK4|UPP_BRUMB Uracil phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=upp PE=3 SV=1 304 527 2.0E-08
sp|A9BWD4|UPP_DELAS Uracil phosphoribosyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=upp PE=3 SV=1 304 527 3.0E-08
sp|B1YEG7|UPP_EXIS2 Uracil phosphoribosyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=upp PE=3 SV=1 304 527 3.0E-08
sp|P47276|UPP_MYCGE Uracil phosphoribosyltransferase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=upp PE=3 SV=1 308 527 3.0E-08
sp|B2A3H5|UPP_NATTJ Uracil phosphoribosyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=upp PE=3 SV=1 304 527 4.0E-08
sp|Q576P9|UPP_BRUAB Uracil phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=upp PE=3 SV=1 308 527 4.0E-08
sp|B2SC51|UPP_BRUA1 Uracil phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=upp PE=3 SV=1 308 527 4.0E-08
sp|P43049|UPP_MYCHO Uracil phosphoribosyltransferase OS=Mycoplasma hominis GN=upp PE=3 SV=1 308 527 4.0E-08
sp|Q24MM7|UPP_DESHY Uracil phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=upp PE=3 SV=1 304 527 5.0E-08
sp|B8FZ68|UPP_DESHD Uracil phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=upp PE=3 SV=1 304 527 5.0E-08
sp|P25697|KPPR_ARATH Phosphoribulokinase, chloroplastic OS=Arabidopsis thaliana GN=At1g32060 PE=2 SV=1 56 239 6.0E-08
sp|Q898X9|UPP_CLOTE Uracil phosphoribosyltransferase OS=Clostridium tetani (strain Massachusetts / E88) GN=upp PE=3 SV=1 308 527 6.0E-08
sp|A1R2Y2|UPP_ARTAT Uracil phosphoribosyltransferase OS=Arthrobacter aurescens (strain TC1) GN=upp PE=3 SV=1 308 527 9.0E-08
sp|P58998|UPP_CORGL Uracil phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=upp PE=3 SV=1 293 527 1.0E-07
sp|A4QC29|UPP_CORGB Uracil phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=upp PE=3 SV=1 293 527 1.0E-07
sp|A6WYH9|UPP_OCHA4 Uracil phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=upp PE=3 SV=1 304 527 1.0E-07
sp|Q180X8|UPP_PEPD6 Uracil phosphoribosyltransferase OS=Peptoclostridium difficile (strain 630) GN=upp PE=3 SV=1 300 527 1.0E-07
sp|A0JSM6|UPP_ARTS2 Uracil phosphoribosyltransferase OS=Arthrobacter sp. (strain FB24) GN=upp PE=3 SV=1 308 527 2.0E-07
sp|A7HJR3|UPP_FERNB Uracil phosphoribosyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=upp PE=3 SV=1 308 527 2.0E-07
sp|C4XJX5|UPP_DESMR Uracil phosphoribosyltransferase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=upp PE=3 SV=1 310 527 2.0E-07
sp|Q0SK44|UPP_RHOJR Uracil phosphoribosyltransferase OS=Rhodococcus jostii (strain RHA1) GN=upp PE=3 SV=1 304 527 2.0E-07
sp|A6W572|UPP_KINRD Uracil phosphoribosyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=upp PE=3 SV=1 308 527 4.0E-07
sp|Q82FS4|UPP_STRAW Uracil phosphoribosyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=upp PE=3 SV=1 308 527 4.0E-07
sp|B2GFU4|UPP_KOCRD Uracil phosphoribosyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=upp PE=3 SV=1 308 527 5.0E-07
sp|P9WFF3|UPP_MYCTU Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=upp PE=1 SV=1 308 527 5.0E-07
sp|P9WFF2|UPP_MYCTO Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=upp PE=3 SV=1 308 527 5.0E-07
sp|A5U7Y3|UPP_MYCTA Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=upp PE=3 SV=1 308 527 5.0E-07
sp|A1KNZ5|UPP_MYCBP Uracil phosphoribosyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=upp PE=3 SV=1 308 527 5.0E-07
sp|P0A659|UPP_MYCBO Uracil phosphoribosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=upp PE=3 SV=1 308 527 5.0E-07
sp|A5CNC6|UPP_CLAM3 Uracil phosphoribosyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=upp PE=3 SV=1 308 527 6.0E-07
sp|Q8CRN4|UPP_STAES Uracil phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=upp PE=3 SV=1 304 527 6.0E-07
sp|Q5HMB1|UPP_STAEQ Uracil phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=upp PE=3 SV=1 304 527 6.0E-07
sp|A1SDD5|UPP_NOCSJ Uracil phosphoribosyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=upp PE=3 SV=1 308 527 8.0E-07
sp|B6IW12|UPP_RHOCS Uracil phosphoribosyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=upp PE=3 SV=1 304 527 8.0E-07
sp|B0T2R0|UPP_CAUSK Uracil phosphoribosyltransferase OS=Caulobacter sp. (strain K31) GN=upp PE=3 SV=1 308 527 8.0E-07
sp|A6LMU0|UPP_THEM4 Uracil phosphoribosyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=upp PE=3 SV=1 308 527 8.0E-07
sp|B5ZAU8|UPP_UREU1 Uracil phosphoribosyltransferase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=upp PE=3 SV=1 310 527 9.0E-07
sp|Q9AK76|UPP_STRCO Uracil phosphoribosyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=upp PE=3 SV=2 308 527 1.0E-06
sp|B1VNY5|UPP_STRGG Uracil phosphoribosyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=upp PE=3 SV=1 308 527 1.0E-06
sp|A6UET4|UPP_SINMW Uracil phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=upp PE=3 SV=1 304 527 1.0E-06
sp|A8YUJ4|UPP_LACH4 Uracil phosphoribosyltransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=upp PE=3 SV=1 304 527 1.0E-06
sp|B9E8F4|UPP_MACCJ Uracil phosphoribosyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=upp PE=3 SV=1 304 527 2.0E-06
sp|O94642|TAD2_SCHPO tRNA-specific adenosine deaminase subunit tad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tad2 PE=3 SV=2 59 261 2.0E-06
sp|Q6NIX4|UPP_CORDI Uracil phosphoribosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=upp PE=3 SV=1 308 527 2.0E-06
sp|Q9PR28|UPP_UREPA Uracil phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=upp PE=3 SV=1 312 527 2.0E-06
sp|B1AIA5|UPP_UREP2 Uracil phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=upp PE=3 SV=1 312 527 2.0E-06
sp|C5BXA3|UPP_BEUC1 Uracil phosphoribosyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=upp PE=3 SV=1 308 527 3.0E-06
sp|C1ARF7|UPP_RHOOB Uracil phosphoribosyltransferase OS=Rhodococcus opacus (strain B4) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|Q12084|DAS2_YEAST Putative uridine kinase DAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAS2 PE=1 SV=1 58 266 3.0E-06
sp|Q9RGY8|UPP_LACAC Uracil phosphoribosyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=upp PE=3 SV=2 304 527 3.0E-06
sp|P67397|UPP_STAAW Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|A8YY79|UPP_STAAT Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|Q6G7J8|UPP_STAAS Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|Q6GEW3|UPP_STAAR Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|P67396|UPP_STAAN Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=upp PE=1 SV=1 304 527 3.0E-06
sp|P67395|UPP_STAAM Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|A6QIV6|UPP_STAAE Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Newman) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|Q5HE88|UPP_STAAC Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|Q2YUJ2|UPP_STAAB Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|A5IUQ7|UPP_STAA9 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain JH9) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|Q2FWE6|UPP_STAA8 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|Q2FF16|UPP_STAA3 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|A6U3J7|UPP_STAA2 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain JH1) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|A7X4V6|UPP_STAA1 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=upp PE=3 SV=1 304 527 3.0E-06
sp|B8DVI9|UPP_BIFA0 Uracil phosphoribosyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=upp PE=3 SV=1 293 527 4.0E-06
sp|C5CLM9|UPP_VARPS Uracil phosphoribosyltransferase OS=Variovorax paradoxus (strain S110) GN=upp PE=3 SV=1 304 527 4.0E-06
sp|Q67TC9|UPP_SYMTH Uracil phosphoribosyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=upp PE=3 SV=1 304 527 4.0E-06
sp|Q8RG35|UPP_FUSNN Uracil phosphoribosyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=upp PE=3 SV=2 308 527 4.0E-06
sp|C4LKC1|UPP_CORK4 Uracil phosphoribosyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=upp PE=3 SV=1 308 527 5.0E-06
sp|B1VF60|UPP_CORU7 Uracil phosphoribosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=upp PE=3 SV=1 293 527 5.0E-06
sp|Q9GNF0|UCKD_DICDI Uridine-cytidine kinase D OS=Dictyostelium discoideum GN=udkD PE=2 SV=1 60 266 8.0E-06
sp|A9FRP1|COAA_SORC5 Pantothenate kinase OS=Sorangium cellulosum (strain So ce56) GN=coaA PE=3 SV=1 58 257 8.0E-06
sp|Q5Z187|UPP_NOCFA Uracil phosphoribosyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=upp PE=3 SV=1 307 527 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0005524 ATP binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|085170
MSNQLLKHVLSGPSIISTSPNPPGKDLKLFQPKKNTVLVSHGRPPWYGENGSLIGDAFVIGVAGGSASGKTYVAR
EIVRSLGSIPTVIILSQDSFYKYHSPEELALAHANMLDFDHPDAIDVPMFVNCLADLKAFRQSNIPVYSFAEHQR
LAETKYLYGATVIIAEGILALHDPSLRALYDLKIFVQCDSDLMLARRIKRDIKERGRSVEGILDQYLRYVKPSYD
NFVRPTASHADIIVPGYNNSVAIELICTHVRRQLQERSNQFREKIAIPRPGIKSKFEYTTPSPTPEELDLTVLPN
TSQLQGIFTILRDKKCSRQDFVFFVDRLSTLLVEYALQHLPYVPKTVVTPVGIEAPGKQLDANYMCGVCIQRSGG
TLERGFRRVIRDVPMGSLLIQSDAATGEPMCLQVKLPAYIRNRHTAEDTWVFILDAQIGTGAAAFMSIRILLDHG
VKEEHIVYVAFLVARGGGISIFRRAFPRVKIVCAEVDDEMEEGWLEGVQDEVTNPGGLGRKVWIMQPGLGQIGDR
YYL*
Coding >AgabiH97|085170
ATGTCGAACCAACTGCTTAAGCATGTTTTAAGCGGTCCTTCGATCATATCCACGTCGCCGAATCCTCCAGGGAAG
GACTTGAAACTCTTCCAACCCAAGAAGAACACAGTACTCGTATCTCATGGTCGACCTCCTTGGTATGGAGAAAAT
GGTAGCCTCATTGGAGACGCATTCGTAATTGGTGTGGCAGGAGGATCCGCGAGTGGAAAGACCTACGTAGCAAGA
GAAATCGTCCGTTCGCTGGGATCCATCCCGACTGTCATCATCTTATCACAAGACAGTTTTTACAAATACCACTCA
CCAGAGGAGCTTGCCTTGGCCCACGCCAACATGCTTGATTTCGATCATCCAGATGCTATCGACGTGCCTATGTTT
GTAAATTGCCTAGCAGATCTCAAAGCGTTTAGGCAGTCAAACATTCCCGTCTATTCCTTTGCCGAGCATCAACGG
TTAGCAGAGACCAAATATCTCTATGGAGCCACTGTCATCATCGCCGAAGGGATTCTGGCGCTGCATGACCCATCA
CTGCGCGCATTGTATGATTTAAAAATTTTTGTGCAATGCGACTCGGACTTGATGCTCGCGCGGCGGATTAAGAGG
GATATCAAAGAACGAGGCCGTAGCGTCGAAGGCATCCTAGACCAGTATCTTCGCTACGTCAAGCCATCTTATGAC
AATTTTGTACGCCCGACAGCTTCTCACGCAGACATTATTGTTCCTGGGTATAACAATTCTGTTGCTATCGAGCTC
ATATGCACCCATGTCAGACGTCAACTGCAGGAACGTTCAAATCAATTCCGTGAGAAGATAGCCATTCCCCGACCG
GGTATCAAATCAAAGTTCGAATATACTACACCATCACCTACCCCTGAGGAACTCGATTTGACTGTCCTCCCCAAC
ACATCCCAACTCCAGGGTATCTTCACGATTTTACGAGACAAGAAGTGCAGTCGTCAAGACTTTGTGTTCTTTGTC
GATCGTCTCTCTACACTTCTGGTGGAATATGCTTTGCAACATCTTCCGTACGTACCAAAGACCGTGGTAACACCA
GTCGGCATCGAGGCACCCGGCAAGCAGCTAGACGCAAATTACATGTGTGGTGTATGCATCCAACGGTCCGGTGGC
ACTCTTGAGCGTGGGTTTCGGCGCGTTATACGTGATGTGCCAATGGGATCTCTGCTGATCCAATCTGATGCGGCC
ACGGGTGAACCTATGTGTCTACAGGTTAAGTTACCGGCATATATACGGAATCGTCACACGGCCGAGGATACTTGG
GTCTTCATACTCGATGCACAGATCGGCACGGGAGCGGCTGCGTTCATGTCCATCCGCATTCTTCTCGACCACGGT
GTTAAAGAGGAACATATTGTATATGTGGCATTCCTTGTAGCCCGCGGCGGAGGTATCTCTATCTTCCGTCGTGCA
TTCCCTAGGGTCAAAATTGTCTGCGCTGAAGTAGACGATGAAATGGAGGAAGGATGGCTGGAAGGTGTTCAAGAT
GAGGTCACAAATCCGGGCGGACTTGGGAGGAAAGTTTGGATCATGCAACCCGGACTGGGACAAATAGGTGATCGT
TATTATCTCTAA
Transcript >AgabiH97|085170
ATGTCGAACCAACTGCTTAAGCATGTTTTAAGCGGTCCTTCGATCATATCCACGTCGCCGAATCCTCCAGGGAAG
GACTTGAAACTCTTCCAACCCAAGAAGAACACAGTACTCGTATCTCATGGTCGACCTCCTTGGTATGGAGAAAAT
GGTAGCCTCATTGGAGACGCATTCGTAATTGGTGTGGCAGGAGGATCCGCGAGTGGAAAGACCTACGTAGCAAGA
GAAATCGTCCGTTCGCTGGGATCCATCCCGACTGTCATCATCTTATCACAAGACAGTTTTTACAAATACCACTCA
CCAGAGGAGCTTGCCTTGGCCCACGCCAACATGCTTGATTTCGATCATCCAGATGCTATCGACGTGCCTATGTTT
GTAAATTGCCTAGCAGATCTCAAAGCGTTTAGGCAGTCAAACATTCCCGTCTATTCCTTTGCCGAGCATCAACGG
TTAGCAGAGACCAAATATCTCTATGGAGCCACTGTCATCATCGCCGAAGGGATTCTGGCGCTGCATGACCCATCA
CTGCGCGCATTGTATGATTTAAAAATTTTTGTGCAATGCGACTCGGACTTGATGCTCGCGCGGCGGATTAAGAGG
GATATCAAAGAACGAGGCCGTAGCGTCGAAGGCATCCTAGACCAGTATCTTCGCTACGTCAAGCCATCTTATGAC
AATTTTGTACGCCCGACAGCTTCTCACGCAGACATTATTGTTCCTGGGTATAACAATTCTGTTGCTATCGAGCTC
ATATGCACCCATGTCAGACGTCAACTGCAGGAACGTTCAAATCAATTCCGTGAGAAGATAGCCATTCCCCGACCG
GGTATCAAATCAAAGTTCGAATATACTACACCATCACCTACCCCTGAGGAACTCGATTTGACTGTCCTCCCCAAC
ACATCCCAACTCCAGGGTATCTTCACGATTTTACGAGACAAGAAGTGCAGTCGTCAAGACTTTGTGTTCTTTGTC
GATCGTCTCTCTACACTTCTGGTGGAATATGCTTTGCAACATCTTCCGTACGTACCAAAGACCGTGGTAACACCA
GTCGGCATCGAGGCACCCGGCAAGCAGCTAGACGCAAATTACATGTGTGGTGTATGCATCCAACGGTCCGGTGGC
ACTCTTGAGCGTGGGTTTCGGCGCGTTATACGTGATGTGCCAATGGGATCTCTGCTGATCCAATCTGATGCGGCC
ACGGGTGAACCTATGTGTCTACAGGTTAAGTTACCGGCATATATACGGAATCGTCACACGGCCGAGGATACTTGG
GTCTTCATACTCGATGCACAGATCGGCACGGGAGCGGCTGCGTTCATGTCCATCCGCATTCTTCTCGACCACGGT
GTTAAAGAGGAACATATTGTATATGTGGCATTCCTTGTAGCCCGCGGCGGAGGTATCTCTATCTTCCGTCGTGCA
TTCCCTAGGGTCAAAATTGTCTGCGCTGAAGTAGACGATGAAATGGAGGAAGGATGGCTGGAAGGTGTTCAAGAT
GAGGTCACAAATCCGGGCGGACTTGGGAGGAAAGTTTGGATCATGCAACCCGGACTGGGACAAATAGGTGATCGT
TATTATCTCTAA
Gene >AgabiH97|085170
ATGTCGAACCAACTGCTTAAGCATGTTTTAAGCGGTCCTTCGATCATATCCACGTCGCCGAATCCTCCAGGGAAG
GACTTGAAACTCTTCCAACCCAAGAAGAACACAGTACTCGTATCTCATGGTCGACCTCCTTGGTATGTGATTTAT
CTCTGTACTTGTCCGTTTGTCTCATTGTTTCGATTGTACTTTAGGTATGGAGAAAATGGTAGCCTCATTGGAGAC
GCATTCGTAATTGGTGTGGCAGGTGAGCAGACGGATTTTCATTCCGTATTCATAGTTCAATTGCCAATACCGATA
ATCGCAGGAGGATCCGCGAGTGGAAAGGTAGATAGTCCAAGCCAACCTCGGGTATAATCGTGCAGACCATTTGTG
ATACAGACCTACGTAGCAAGAGAAATCGTCCGTTCGCTGGGATCCATCCCGACTGTCATCATCTTATCACAAGTA
AGGCTTCGCCATGTTCATATTGCCGATATGCTAATGCAGGCTGAATCAGGACAGTTTTTACAAATACCACTCACC
AGAGGAGCTTGCCTTGGCCCACGCCAACATGCTTGATTTCGATCATCCAGATGCTATCGACGTGCCTATGTTTGT
AAATGTAGGTGTGGAAATACCCAAGCACTCTTACCCGGCTCACTCCGACAAGTGCCTAGCAGATCTCAAAGCGTT
TAGGCAGTCAAACATTCCCGTCTATTCCTTTGCCGAGCATCAACGGTTAGCAGAGACCAAATATCTCTATGGAGC
CACTGTCATCATCGGTAGATCTTCCTCTTAAACATCCGGACTCGGATTTAAGGGGTCTATGGGATAATTCACAGC
CGAAGGGATTCTGGCGCTGCATGACCCATCACTGCGCGCATTGTATGATTTAAAAGTGAGTTGTTCCGTTGTTCG
TTTATCATTCTAATCCTTGCCGTAGATTTTTGTGCAATGCGACTCGGACTTGATGCTCGCGCGGCGGATTAAGAG
GGATATCAAAGAACGAGGCCGTAGCGTCGAAGGCATCCTAGACCAGTGCGGGCTGAAGTAGTTGACAGGAAATCT
TCATCTGATCTATTAACAGGTATCTTCGCTACGTCAAGCCATCTTATGACAATTTTGTACGCCCGACAGCTTCTC
ACGCAGACATTGTGAGTAGGGATCTACTCATGGCAATTTGGATATGTCTAACGTCTGCTTTAGATTGTTCCTGGG
TATAACAATTCTGTTGCTATCGAGCTCATATGCACCCATGTCAGACGTCAACTGCAGGAACGTTCAAATCAATTC
CGTGAGAAGATAGCCATTCCCCGACCGGGTATCAAATCAAAGTTCGAATATACTACACCATCACCTACCCCTGAG
GAACTCGATTTGACTGTCCTCCCCAACACATCCCAACTCCAGGTAAAAGTGATAATTGTCTGATGTTCCTTCACG
TGCTGAATGCATGAGATCACTGCGACAGGGTATCTTCACGATTTTACGAGACAAGAAGTGCAGTCGTCAAGACTT
TGTGTTCTTTGTCGATCGTCTCTCTACACTTCTGGTGGAATATGCTTTGCAACATCTTCCGTACGTACCAAAGAC
CGTGGTAACACCAGTCGGCATCGAGGCACCCGGCAAGCAGCTAGACGCAAATGTAAAGAAGCTCTCTTGAACCTT
CACAACGCAGCTGACCAATTTCGATAGTACATGTGTGGTGTATGCATCCAACGGTCGTACGTCTAACTGCTGGCA
GATGTGACGTAATCCTATCCTGAGTCCTGATTCTAGCGGTGGCACTCTTGAGCGTGGGTTTCGGCGCGTTATACG
TGATGTGCCAATGGGATCTCTGCTGATCCAATCTGATGCGGCCACGGGTGAACCTATGTGTCTACAGGTTAAGTT
ACCGGCATATATACGGAATCGTCACACGGCCGAGGATACTTGGGTCTTCATACTCGATGCACAGGTCAGCAGTAT
TTCTGTTGAAAGTGTTCGCGATGTCATTTTTTGAAGCATAGATCGGCACGGGAGCGGCTGCGTTCATGTCCATCC
GCATTCTTCTCGACCACGGTGTTAAAGAGGAACATATTGTATATGTGGCATTCCTTGTAGCCCGCGGCGGAGGTA
TCTCTATCTTCCGTCGTGCATTCCCTAGGGTCAAAATTGTCTGCGCTGAAGTAGACGATGAAATGGAGGAAGGAT
GGCTGGAAGGTGTTCAAGATGAGGTCACAAATCCGGGCGGACTTGGGAGGAAAGTTTGGATCATGCAACCCGGAC
TGGGACAAATAGGTAGGTTTCCCCAGCACTCTTTTTGATTTTCCTTGGTTGAACAACAGATGATATGTCATGCTT
TTCCTCTTTGAAGGTGATCGTTATTATCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail