Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084700
Gene name
Locationscaffold_5:1615602..1617005
Strand+
Gene length (bp)1403
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16884 ADH_N_2 N-terminal domain of oxidoreductase 7.8E-27 7 117
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.1E-17 165 293

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 7 343 2.0E-60
sp|P76113|CURA_ECOLI NADPH-dependent curcumin reductase OS=Escherichia coli (strain K12) GN=curA PE=1 SV=3 4 341 6.0E-58
sp|Q9SLN8|DBR_TOBAC 2-alkenal reductase (NADP(+)-dependent) OS=Nicotiana tabacum GN=DBR PE=1 SV=1 38 341 3.0E-50
sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 38 341 9.0E-47
sp|Q5BK81|PTGR2_RAT Prostaglandin reductase 2 OS=Rattus norvegicus GN=Ptgr2 PE=2 SV=2 7 343 3.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 7 343 2.0E-60
sp|P76113|CURA_ECOLI NADPH-dependent curcumin reductase OS=Escherichia coli (strain K12) GN=curA PE=1 SV=3 4 341 6.0E-58
sp|Q9SLN8|DBR_TOBAC 2-alkenal reductase (NADP(+)-dependent) OS=Nicotiana tabacum GN=DBR PE=1 SV=1 38 341 3.0E-50
sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 38 341 9.0E-47
sp|Q5BK81|PTGR2_RAT Prostaglandin reductase 2 OS=Rattus norvegicus GN=Ptgr2 PE=2 SV=2 7 343 3.0E-45
sp|Q32L99|PTGR2_BOVIN Prostaglandin reductase 2 OS=Bos taurus GN=PTGR2 PE=2 SV=1 7 343 5.0E-45
sp|Q39172|P1_ARATH NADP-dependent alkenal double bond reductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 38 341 8.0E-45
sp|Q8VDQ1|PTGR2_MOUSE Prostaglandin reductase 2 OS=Mus musculus GN=Ptgr2 PE=1 SV=2 7 343 5.0E-44
sp|Q5R806|PTGR2_PONAB Prostaglandin reductase 2 OS=Pongo abelii GN=PTGR2 PE=2 SV=2 7 343 1.0E-43
sp|Q8N8N7|PTGR2_HUMAN Prostaglandin reductase 2 OS=Homo sapiens GN=PTGR2 PE=1 SV=1 7 343 1.0E-43
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 43 341 2.0E-42
sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 41 337 3.0E-41
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 39 336 1.0E-40
sp|Q14914|PTGR1_HUMAN Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 39 337 7.0E-40
sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 29 337 8.0E-40
sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 7 341 1.0E-39
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 32 337 1.0E-39
sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 21 337 2.0E-38
sp|Q03102|YMN1_YEAST Uncharacterized membrane protein YML131W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML131W PE=1 SV=1 41 341 2.0E-37
sp|Q28719|PTGR1_RABIT Prostaglandin reductase 1 OS=Oryctolagus cuniculus GN=PTGR1 PE=2 SV=1 39 333 7.0E-34
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 37 346 1.0E-27
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 3 346 3.0E-27
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 37 346 1.0E-23
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 64 338 6.0E-19
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 37 251 5.0E-17
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 37 251 1.0E-15
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 37 251 1.0E-15
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 37 250 5.0E-15
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 37 251 1.0E-14
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 37 251 3.0E-14
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 67 280 4.0E-14
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 67 281 7.0E-14
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 78 341 9.0E-14
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 37 250 2.0E-12
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 27 250 1.0E-11
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 132 343 8.0E-11
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 132 343 8.0E-11
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 77 344 3.0E-10
sp|Q9XXC8|MECR2_CAEEL Probable trans-2-enoyl-CoA reductase 2, mitochondrial OS=Caenorhabditis elegans GN=Y48A6B.9 PE=3 SV=1 35 203 9.0E-10
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 81 338 6.0E-09
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 21 237 6.0E-09
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 80 259 2.0E-08
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 36 250 3.0E-08
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 81 296 5.0E-08
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 77 237 8.0E-08
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 139 341 9.0E-08
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 81 230 9.0E-08
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 77 344 1.0E-07
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 66 230 1.0E-07
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 77 344 1.0E-07
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 81 247 4.0E-07
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 104 260 8.0E-07
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 37 338 1.0E-06
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 26 229 2.0E-06
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 81 296 2.0E-06
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 37 338 3.0E-06
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 138 286 4.0E-06
sp|O42909|YBI2_SCHPO Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.02c PE=3 SV=1 133 233 5.0E-06
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 81 247 7.0E-06
sp|Q54YT4|MECR_DICDI Trans-2-enoyl-CoA reductase, mitochondrial OS=Dictyostelium discoideum GN=mecr PE=3 SV=1 39 288 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084700
MSPQNYKRIVLNSRPEGDIEPNTFRTEVLPFTSLGSPGNKQCLVQCTWLSLDPAMRGWLRDTRSYLPPVQIGETM
RAQGLGVVLAVGEDSKFKVGDHVTGAWGMTEYAVVPDQRLEKLEIYPGVQPLDYLNTLGGSGLTAYFGLKKIGEL
KPGEKLVVSGAAGSVGSLVCQLGKAAGAKVYAIAGTSEKCEWLEKDIGVEKAFNYKSPTFMEDFKKSVGYLDVFF
DNVGGDMLDSMLGRLNKDARIILCGAISQYNATKPKGLQSYLNLISQRAKMQGFIVFDYAQEYPVAIAEMGKGLV
DGSIQRRFHIVDGGIEEAPRALPMLFSGGNTGKLVVKVAEDPSAKL*
Coding >AgabiH97|084700
ATGTCTCCACAAAACTACAAACGCATTGTTCTCAACTCACGGCCTGAAGGCGACATCGAACCAAACACATTTCGC
ACTGAAGTGCTTCCGTTCACTTCACTTGGTTCTCCAGGAAATAAGCAATGTCTAGTGCAGTGCACATGGCTGTCG
CTAGATCCTGCTATGAGAGGTTGGCTCCGTGACACACGAAGCTATCTGCCTCCAGTTCAGATTGGTGAAACTATG
AGGGCACAAGGATTGGGCGTTGTTCTTGCTGTCGGAGAGGACAGTAAGTTCAAGGTTGGCGACCATGTTACTGGC
GCATGGGGGATGACGGAGTACGCGGTTGTTCCTGATCAAAGACTTGAGAAGCTTGAGATCTATCCAGGTGTTCAA
CCGTTGGACTACCTGAATACTCTTGGTGGATCCGGACTCACAGCGTATTTCGGACTCAAAAAGATTGGTGAGCTC
AAACCAGGAGAGAAGCTCGTCGTATCAGGAGCCGCAGGCTCAGTCGGTTCTCTTGTGTGCCAACTTGGAAAGGCT
GCAGGAGCAAAAGTCTATGCCATCGCTGGTACATCAGAGAAATGTGAGTGGTTAGAAAAGGATATTGGTGTCGAG
AAGGCTTTCAACTACAAGAGTCCGACATTCATGGAAGACTTTAAAAAGAGTGTGGGATACCTGGATGTGTTCTTT
GACAACGTTGGTGGAGATATGTTGGATTCCATGCTGGGAAGACTGAATAAGGATGCTCGGATTATCCTTTGTGGG
GCCATCTCGCAGTACAACGCGACAAAGCCAAAGGGTCTTCAATCGTATCTTAACCTGATATCTCAGCGTGCCAAA
ATGCAAGGCTTCATCGTGTTCGATTATGCCCAAGAGTATCCTGTTGCTATCGCAGAAATGGGCAAAGGACTGGTC
GATGGCAGTATCCAACGGCGTTTCCACATCGTTGACGGTGGTATTGAAGAGGCACCTAGAGCTTTACCAATGCTG
TTTTCAGGCGGGAATACGGGTAAACTAGTCGTAAAGGTGGCGGAAGACCCCAGCGCGAAGCTATGA
Transcript >AgabiH97|084700
ATGTCTCCACAAAACTACAAACGCATTGTTCTCAACTCACGGCCTGAAGGCGACATCGAACCAAACACATTTCGC
ACTGAAGTGCTTCCGTTCACTTCACTTGGTTCTCCAGGAAATAAGCAATGTCTAGTGCAGTGCACATGGCTGTCG
CTAGATCCTGCTATGAGAGGTTGGCTCCGTGACACACGAAGCTATCTGCCTCCAGTTCAGATTGGTGAAACTATG
AGGGCACAAGGATTGGGCGTTGTTCTTGCTGTCGGAGAGGACAGTAAGTTCAAGGTTGGCGACCATGTTACTGGC
GCATGGGGGATGACGGAGTACGCGGTTGTTCCTGATCAAAGACTTGAGAAGCTTGAGATCTATCCAGGTGTTCAA
CCGTTGGACTACCTGAATACTCTTGGTGGATCCGGACTCACAGCGTATTTCGGACTCAAAAAGATTGGTGAGCTC
AAACCAGGAGAGAAGCTCGTCGTATCAGGAGCCGCAGGCTCAGTCGGTTCTCTTGTGTGCCAACTTGGAAAGGCT
GCAGGAGCAAAAGTCTATGCCATCGCTGGTACATCAGAGAAATGTGAGTGGTTAGAAAAGGATATTGGTGTCGAG
AAGGCTTTCAACTACAAGAGTCCGACATTCATGGAAGACTTTAAAAAGAGTGTGGGATACCTGGATGTGTTCTTT
GACAACGTTGGTGGAGATATGTTGGATTCCATGCTGGGAAGACTGAATAAGGATGCTCGGATTATCCTTTGTGGG
GCCATCTCGCAGTACAACGCGACAAAGCCAAAGGGTCTTCAATCGTATCTTAACCTGATATCTCAGCGTGCCAAA
ATGCAAGGCTTCATCGTGTTCGATTATGCCCAAGAGTATCCTGTTGCTATCGCAGAAATGGGCAAAGGACTGGTC
GATGGCAGTATCCAACGGCGTTTCCACATCGTTGACGGTGGTATTGAAGAGGCACCTAGAGCTTTACCAATGCTG
TTTTCAGGCGGGAATACGGGTAAACTAGTCGTAAAGGTGGCGGAAGACCCCAGCGCGAAGCTATGA
Gene >AgabiH97|084700
ATGTCTCCACAAAACTACAAACGCATTGTTCTCAACTCACGGCCTGAAGGCGACATCGAACCAAACACATTTCGC
ACTGAAGTGCTTCCGTTCACTTCACTTGGTTCTCCAGGAAATAAGCAATGTCTAGTGCAGTGCACATGGCTGTCG
CTAGATCCTGCTATGAGAGGTTGGCTCCGTGACACACGAAGCTATCTGCCTCCAGTTCAGATTGGTGAAGTGAGG
CTACAATGTTTTGGTCTACCGTGCAACAGTCCCTGACAAAAACATGATAGACTATGAGGGCACAAGGATTGGGCG
TTGTTCTTGCTGTCGGAGAGGACAGTAAGTTCAAGGTTGGCGACCATGTTACTGGCGCATGGGGTGCGTGTTCTC
AGTCGACCACCGACTTTGCATTGGACTCATTGTGCTGCATAGGGATGACGGAGTACGCGGTTGTTCCTGATCAAA
GACTTGAGAAGCTTGAGTATGTGATTTTTATGTTTTCTTGTTCTTTTTGTTGACGAATATCAGGATCTATCCAGG
TGTTCAACCGTTGGACTACCTGAATACTCTTGGTGGATCCGGACTCACAGCGTATTTCGGACTCAAAAAGATTGG
TGAGCTCAAACCAGGAGAGAAGCTCGTCGTATCAGGAGCCGCAGGCTCAGTCGGTTCTCTTGTGTGCCAACTTGG
AAAGGCTGCAGGAGCAAAAGTCTATGCCATCGCTGGTACATCAGAGAAATGTGAGTGGTTAGAAAAGGATATTGG
TGTCGAGAAGGCTTTCAACTACAAGAGTCCGACATTCATGGAAGACTTTAAAAAGAGTGTGGGATACCTGGATGT
GTTCTTTGACAACGTTGGTGGAGATATGTTGGATTCCATGCTGGGAAGACTGAATAAGGATGCTCGGATTATCCT
TTGTGGTAAGCTTCAATATATAAAGAGAGTGATCTGCGATTAATCGAGACACAGGGGCCATCTCGCAGTACAGTG
AGCAAACTTATCATTCTCGAGTTTTATTTTTCACTGAGAATTCTGTTCAAGACGCGACAAAGCCAAAGGGTCTTC
AATCGTATCTTAACCTGATATCTCAGCGTGCCAAAATGCAAGGCTTCATCGTGTAATGGCATTTTATTTGTTTTC
CCTTTATAAATTTACCGACTCCAACGCTAGGTTCGATTATGCCCAAGAGTATCCTGTTGCTATCGCAGAAATGGG
CAAAGGACTGGTCGATGGCAGTATCCAACGGCGTTTCCACATCGTTGACGGTGGTATTGAAGAGGCACCTAGAGC
TTTACCAATGCTGTTTTCAGGCGGGAATACGGGTAAACTGTATGTGAATATGTCGTCTTATTGCATATGGGCTAA
ATTTGTTCTTCAGAGTCGTAAAGGTGGCGGAAGACCCCAGCGCGAAGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail