Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084590
Gene name
Locationscaffold_5:1590114..1591809
Strand+
Gene length (bp)1695
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 2.5E-11 117 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96V64|EXG_BLUGR Glucan 1,3-beta-glucosidase OS=Blumeria graminis PE=3 SV=1 61 467 5.0E-93
sp|P29717|EXG1_CANAL Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=XOG1 PE=1 SV=4 62 467 1.0E-92
sp|O93983|EXG2_WICAO Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus GN=EXG2 PE=3 SV=1 49 466 7.0E-91
sp|A2RAR6|EXGA_ASPNC Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=exgA PE=3 SV=1 59 467 4.0E-90
sp|Q12700|EXG_SCHOC Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis PE=3 SV=1 52 467 3.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96V64|EXG_BLUGR Glucan 1,3-beta-glucosidase OS=Blumeria graminis PE=3 SV=1 61 467 5.0E-93
sp|P29717|EXG1_CANAL Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=XOG1 PE=1 SV=4 62 467 1.0E-92
sp|O93983|EXG2_WICAO Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus GN=EXG2 PE=3 SV=1 49 466 7.0E-91
sp|A2RAR6|EXGA_ASPNC Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=exgA PE=3 SV=1 59 467 4.0E-90
sp|Q12700|EXG_SCHOC Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis PE=3 SV=1 52 467 3.0E-87
sp|Q8NKF9|EXG_CANOL Glucan 1,3-beta-glucosidase OS=Candida oleophila GN=EXG1 PE=3 SV=1 62 467 4.0E-87
sp|B0XN12|EXGA_ASPFC Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=exgA PE=3 SV=1 59 467 6.0E-87
sp|Q4WK60|EXGA_ASPFU Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=exgA PE=3 SV=1 59 467 1.0E-86
sp|A1CRV0|EXGA_ASPCL Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=exgA PE=3 SV=2 36 467 4.0E-85
sp|A1D4Q5|EXGA_NEOFI Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=exgA PE=3 SV=1 59 467 8.0E-85
sp|Q7Z9L3|EXGA_ASPOR Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgA PE=1 SV=1 56 467 9.0E-85
sp|B8N151|EXGA_ASPFN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgA PE=3 SV=1 56 467 9.0E-85
sp|Q5B5X8|EXGA_EMENI Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=exgA PE=3 SV=2 67 467 2.0E-84
sp|Q12626|EXG_PICAN Glucan 1,3-beta-glucosidase OS=Pichia angusta PE=3 SV=1 62 467 2.0E-82
sp|Q12628|EXG_KLULA Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C05324g PE=3 SV=1 61 467 2.0E-82
sp|Q875R9|EXG_LACK1 Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EXG1 PE=3 SV=1 61 467 4.0E-81
sp|Q876J2|SPR1_SACU7 Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=SPR1 PE=3 SV=1 67 467 1.0E-76
sp|Q0CR35|EXGA_ASPTN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=exgA PE=3 SV=1 59 466 2.0E-75
sp|Q12725|EXG_YARLI Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EXG1 PE=3 SV=2 43 467 3.0E-74
sp|P23776|EXG1_YEAST Glucan 1,3-beta-glucosidase I/II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EXG1 PE=1 SV=1 68 467 6.0E-74
sp|P32603|SPR1_YEAST Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPR1 PE=2 SV=1 67 467 6.0E-74
sp|Q876J3|EXG_SACU7 Glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=EXG1 PE=3 SV=1 68 467 3.0E-73
sp|D4AJL7|EXG1_ARTBC Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04467 PE=1 SV=1 68 465 4.0E-69
sp|O93939|EXG1_WICAO Glucan 1,3-beta-glucosidase 1 OS=Wickerhamomyces anomalus GN=EXG1 PE=3 SV=1 61 465 6.0E-69
sp|Q9URU6|EXG1_SCHPO Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exg1 PE=2 SV=1 61 467 8.0E-67
sp|A1CTI3|EXGD_ASPCL Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=exgD PE=3 SV=1 50 458 1.0E-65
sp|Q5AIA1|EXG2_CANAL Glucan 1,3-beta-glucosidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EXG2 PE=1 SV=1 66 465 2.0E-65
sp|Q0CHZ8|EXGD_ASPTN Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=exgD PE=3 SV=1 46 458 5.0E-64
sp|A2QX52|EXGD_ASPNC Probable glucan 1,3-beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=exgD PE=3 SV=1 49 458 1.0E-63
sp|P52911|EXG2_YEAST Glucan 1,3-beta-glucosidase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EXG2 PE=1 SV=1 66 457 2.0E-62
sp|A1DMX4|EXGD_NEOFI Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=exgD PE=3 SV=1 50 457 6.0E-61
sp|B8NNK9|EXGD_ASPFN Probable glucan 1,3-beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgD PE=3 SV=1 46 458 7.0E-60
sp|Q2UMV7|EXGD_ASPOR Probable glucan 1,3-beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgD PE=3 SV=2 46 458 8.0E-60
sp|Q4WMP0|EXGD_ASPFU Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=exgD PE=3 SV=1 50 457 1.0E-59
sp|B0Y7W2|EXGD_ASPFC Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=exgD PE=3 SV=1 50 457 1.0E-59
sp|Q5AVZ7|EXGD_EMENI Glucan 1,3-beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=exgD PE=2 SV=1 50 457 3.0E-58
sp|Q10444|EXG2_SCHPO Glucan 1,3-beta-glucosidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exg2 PE=3 SV=1 46 458 8.0E-49
sp|Q0C8Z0|EXGB_ASPTN Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=exgB PE=3 SV=1 61 459 5.0E-36
sp|A1DGM6|EXGB_NEOFI Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=exgB PE=3 SV=1 35 459 4.0E-34
sp|B0XRX9|EXGB_ASPFC Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=exgB PE=3 SV=1 35 451 2.0E-33
sp|Q2TZQ9|EXGB_ASPOR Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgB PE=3 SV=1 61 459 2.0E-32
sp|Q4X1N4|EXGB_ASPFU Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=exgB PE=3 SV=1 35 451 2.0E-32
sp|B8NBJ4|EXGB_ASPFN Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgB PE=3 SV=1 61 455 3.0E-29
sp|Q5B6Q3|EXGB_EMENI Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=exgB PE=2 SV=1 67 459 1.0E-26
sp|O74799|EXG3_SCHPO Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exg3 PE=3 SV=1 63 360 2.0E-20
sp|P38081|YBQ6_YEAST Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR056W PE=1 SV=1 30 460 1.0E-18
sp|A3DJ77|GUNC_CLOTH Endoglucanase C OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celC PE=3 SV=1 116 245 2.0E-10
sp|P23340|GUNC_CLOSF Endoglucanase C307 OS=Clostridium sp. (strain F1) GN=celC307 PE=1 SV=1 116 245 2.0E-10
sp|P0C2S3|GUNC_CLOTM Endoglucanase C OS=Clostridium thermocellum GN=celC PE=1 SV=1 116 245 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0071704 organic substance metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084590
MFVLRLAALCALPVCFASKCALRLKQQAHGPQVPLATPSLPPPTQTTPANPSLPTPTITPFDYSKIKVRGVNLGG
WLVLEPWITPSVFENTGNDAIVDEFTLGQLMDPDDARKLLKAHWESWITEDDFVAIKAAGLNHVRIPIGYWSIPL
PASATNTSIDPSPYIPGAWPYFLRALDWAKKHSIRVILDIHGAPGSQNGYDNSGQRTSNPVWALNPAHVTRTVDT
IRWLTQTVGGSVDVIELLNEGGGFRGQIWIDSMRQYFLDGYDAVRAVEPNSSRPLGVMIGDGFLTLQPWDGFLAA
PRGHNILMDTHAYQIFSDGELSRSFSEHVSFACSTLLPSYVSYASSNHWTVLGEWSTALTDCAKWLNGRGVGARW
DNTAFPSDTSVFHDSCDAWTGSWNGTDGGKGFSDEYKDMLRHYWELQVEIGEAVQGWVYWTWKAEIADEWSYQMG
LEGGWIPQDPTDRKYPNIYK*
Coding >AgabiH97|084590
ATGTTCGTCCTGCGCCTTGCTGCCCTGTGCGCGCTGCCGGTGTGTTTCGCCTCCAAATGCGCCCTCCGACTCAAA
CAGCAGGCGCACGGACCACAAGTCCCACTCGCTACTCCCTCCCTCCCACCGCCCACCCAGACCACTCCGGCTAAT
CCATCTCTGCCGACCCCCACCATCACCCCCTTTGATTACTCGAAAATCAAAGTACGGGGTGTCAACCTAGGTGGA
TGGCTTGTTCTCGAACCTTGGATCACCCCCAGCGTATTCGAGAACACCGGAAACGATGCTATCGTCGATGAATTC
ACACTGGGCCAACTGATGGACCCCGATGATGCTCGCAAACTCCTGAAAGCCCACTGGGAATCTTGGATTACCGAA
GACGACTTTGTTGCCATCAAAGCTGCAGGCCTCAATCACGTCCGAATACCCATTGGTTACTGGTCCATTCCTCTC
CCGGCCTCCGCCACAAATACCTCCATAGATCCCTCTCCTTATATTCCCGGTGCATGGCCCTACTTTCTTCGCGCC
CTTGACTGGGCCAAGAAACACTCCATCCGCGTCATTCTTGATATCCACGGTGCACCTGGTTCTCAAAACGGCTAT
GACAACTCGGGTCAACGCACGTCCAATCCTGTTTGGGCACTCAATCCAGCTCATGTCACAAGAACCGTTGACACT
ATTCGGTGGCTCACACAAACCGTCGGCGGATCAGTTGATGTTATTGAATTGCTCAACGAAGGTGGAGGTTTCCGC
GGTCAAATCTGGATTGATAGCATGCGTCAATACTTTCTTGACGGTTATGATGCCGTTCGCGCTGTCGAGCCTAAT
AGCAGCAGACCCTTGGGTGTCATGATCGGTGATGGCTTCCTAACCCTCCAGCCCTGGGATGGTTTCCTTGCCGCC
CCCCGAGGACATAATATTCTCATGGACACTCATGCGTATCAGATTTTCAGCGACGGCGAGTTGAGTCGCTCCTTT
TCTGAACACGTTTCTTTCGCTTGTTCCACCCTTCTCCCTTCCTACGTTTCCTACGCTTCTTCCAATCACTGGACC
GTTTTAGGTGAATGGTCGACAGCGCTTACGGATTGTGCTAAATGGCTCAACGGTCGTGGCGTTGGTGCAAGATGG
GACAATACTGCTTTCCCATCGGATACGAGCGTCTTTCATGATAGTTGTGATGCTTGGACGGGGAGTTGGAATGGA
ACTGATGGGGGAAAGGGATTTTCAGATGAATACAAAGATATGTTAAGACATTATTGGGAGCTTCAAGTCGAGATT
GGTGAAGCTGTGCAAGGCTGGGTGTATTGGACCTGGAAGGCGGAAATTGCTGATGAATGGAGTTATCAAATGGGC
TTGGAAGGTGGCTGGATACCACAGGACCCAACGGATCGCAAATACCCGAATATATACAAATGA
Transcript >AgabiH97|084590
ATGTTCGTCCTGCGCCTTGCTGCCCTGTGCGCGCTGCCGGTGTGTTTCGCCTCCAAATGCGCCCTCCGACTCAAA
CAGCAGGCGCACGGACCACAAGTCCCACTCGCTACTCCCTCCCTCCCACCGCCCACCCAGACCACTCCGGCTAAT
CCATCTCTGCCGACCCCCACCATCACCCCCTTTGATTACTCGAAAATCAAAGTACGGGGTGTCAACCTAGGTGGA
TGGCTTGTTCTCGAACCTTGGATCACCCCCAGCGTATTCGAGAACACCGGAAACGATGCTATCGTCGATGAATTC
ACACTGGGCCAACTGATGGACCCCGATGATGCTCGCAAACTCCTGAAAGCCCACTGGGAATCTTGGATTACCGAA
GACGACTTTGTTGCCATCAAAGCTGCAGGCCTCAATCACGTCCGAATACCCATTGGTTACTGGTCCATTCCTCTC
CCGGCCTCCGCCACAAATACCTCCATAGATCCCTCTCCTTATATTCCCGGTGCATGGCCCTACTTTCTTCGCGCC
CTTGACTGGGCCAAGAAACACTCCATCCGCGTCATTCTTGATATCCACGGTGCACCTGGTTCTCAAAACGGCTAT
GACAACTCGGGTCAACGCACGTCCAATCCTGTTTGGGCACTCAATCCAGCTCATGTCACAAGAACCGTTGACACT
ATTCGGTGGCTCACACAAACCGTCGGCGGATCAGTTGATGTTATTGAATTGCTCAACGAAGGTGGAGGTTTCCGC
GGTCAAATCTGGATTGATAGCATGCGTCAATACTTTCTTGACGGTTATGATGCCGTTCGCGCTGTCGAGCCTAAT
AGCAGCAGACCCTTGGGTGTCATGATCGGTGATGGCTTCCTAACCCTCCAGCCCTGGGATGGTTTCCTTGCCGCC
CCCCGAGGACATAATATTCTCATGGACACTCATGCGTATCAGATTTTCAGCGACGGCGAGTTGAGTCGCTCCTTT
TCTGAACACGTTTCTTTCGCTTGTTCCACCCTTCTCCCTTCCTACGTTTCCTACGCTTCTTCCAATCACTGGACC
GTTTTAGGTGAATGGTCGACAGCGCTTACGGATTGTGCTAAATGGCTCAACGGTCGTGGCGTTGGTGCAAGATGG
GACAATACTGCTTTCCCATCGGATACGAGCGTCTTTCATGATAGTTGTGATGCTTGGACGGGGAGTTGGAATGGA
ACTGATGGGGGAAAGGGATTTTCAGATGAATACAAAGATATGTTAAGACATTATTGGGAGCTTCAAGTCGAGATT
GGTGAAGCTGTGCAAGGCTGGGTGTATTGGACCTGGAAGGCGGAAATTGCTGATGAATGGAGTTATCAAATGGGC
TTGGAAGGTGGCTGGATACCACAGGACCCAACGGATCGCAAATACCCGAATATATACAAATGA
Gene >AgabiH97|084590
ATGTTCGTCCTGCGCCTTGCTGCCCTGTGCGCGCTGCCGGTGTGTTTCGCCTCCAAATGCGCCCTCCGACTCAAA
CAGCAGGCGCACGGACCACAAGTCCCACTCGCTACTCCCTCCCTCCCACCGCCCACCCAGACCACTCCGGCTAAT
CCATCTCTGCCGACCCCCACCATCACCCCCTTTGATTACTCGAAAATCAAAGTACGGGGTGTCAACCTGTAAGTG
GATTGACATCTACCCTGGCTTGCCTCATCATTCCCTCTGACTTACTCGTCGCAACTCCCAGAGGTGGATGGCTTG
TTCTCGAAGTACGTCCCCCCAGCCCGAGTCCAATTCAACTCACACGCTAACATGCTCCGGCGCAGCCTTGGATCA
CCCCCAGCGTATTCGAGAACACCGGAAACGATGCTATCGTCGATGAATTCACACTGGGCCAACTGATGGACCCCG
ATGATGCTCGCAAACTCCTGAAAGCCCACTGGGAATCTGTTCGTAGCACTGGCATGGCTTATATTTATAACTGAC
GTGTGTCTGCCAGTGGATTACCGAAGACGACTTTGTTGCCATCAAAGCTGCAGGCCTCAATCACGTCCGGTGTGC
CCCCTTTATCCTTGCCCTATCAAAATAATCCTCATTTTTATTTCAGAATACCCATTGGTTACTGGTCCATTCCTC
TCCCGGCCTCCGCCACAAATACCTCCATAGATCCCTCTCCTTATATTCCCGGTGCATGGCCCTACTTTCTTCGCG
CCCTTGACTGGGCCAAGAAACACTCCATCCGCGTCATTCTTGATATCCACGGTGCACCTGGTTCTCAAAACGGCT
ATGACAACTCGGGTCAACGCACGTCCAATCCTGTTTGGGCACTCAATCCAGCTCATGTCACAAGAACCGTTGACA
CTATTCGGTGGCTCACACAAACCGTCGGCGGATCAGTTGATGTTATTGAATTGCTCAACGAAGGTGGAGGTTTCC
GCGGTCAAATCTGGATTGATAGCATGCGTCAATACTTTCTTGACGGTTATGATGCCGTTCGCGCTGTCGAGCCTA
ATAGCAGCAGACCCTTGGGTGTCATGATCGGTGATGGCTTCCTAACCCTCCAGCCCTGGGATGGTTTCCTTGCCG
CCCCCCGAGGACATAATATTCTCATGGACACTCATGCGTATCAGATTTTCAGCGACGGCGAGTTGAGTCGCTCCT
TTTCTGAACACGTTTCTTTCGCTTGTTCCACCCTTCTCCCTTCCTACGTTTCCTACGCTTCTTCCAATCACTGGA
CCGTTTTAGGTGAATGGTCGACAGCGCTTACGGATTGTGCTAAATGGCTCAACGGTCGTGGCGTTGGTGCAAGAT
GGGACAATACTGCTTTCCCATCGGATACGAGCGTCTTTCATGATAGTTGTGATGCTTGGACGGGGAGTTGGAATG
GAACTGATGGGGGAAAGGGATTTTCAGATGAATACAAAGATATGTTAAGACATTATTGGGAGCTTCAAGTCGAGA
TTGGTGAAGCTGTGCAAGGCTGGGTGTATTGGACCTGGAAGGTACGTTTCACTATCCTCAATCCTTAACGCCCTT
TCACTGACGTGTACTGTAAAGGCGGAAATTGCTGATGAATGGAGTTATCAAATGGGCTTGGAAGGTGGCTGGATA
CCACAGGACCCAACGGATCGCAAATACCCGAATATATACAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail