Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084560
Gene name
Locationscaffold_5:1584896..1586674
Strand-
Gene length (bp)1778
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 9.2E-26 20 123
PF00085 Thioredoxin Thioredoxin 3.5E-25 141 245
PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain 6.8E-25 263 353
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 8.0E-07 19 142
PF13098 Thioredoxin_2 Thioredoxin-like domain 1.1E-07 158 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 11 363 2.0E-100
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 22 354 1.0E-99
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 23 354 1.0E-89
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 19 353 4.0E-89
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 1 353 9.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 11 363 2.0E-100
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 22 354 1.0E-99
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 23 354 1.0E-89
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 19 353 4.0E-89
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 1 353 9.0E-86
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 1 353 7.0E-84
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 1 354 6.0E-83
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 19 353 2.0E-81
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 20 247 5.0E-42
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 20 248 9.0E-42
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 20 346 4.0E-40
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 16 246 6.0E-39
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 23 248 9.0E-39
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 23 248 2.0E-38
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 16 250 2.0E-38
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 20 235 4.0E-36
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 6 241 7.0E-36
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 6 241 3.0E-35
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 6 241 1.0E-34
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 6 241 1.0E-34
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 20 244 2.0E-34
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 6 241 2.0E-34
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 8 235 8.0E-34
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 3 261 1.0E-29
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 39 247 2.0E-29
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 39 247 4.0E-28
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 17 318 1.0E-25
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 118 245 3.0E-24
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 17 318 6.0E-24
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 17 245 9.0E-24
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 17 318 1.0E-23
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 19 264 3.0E-23
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 4 243 5.0E-23
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 19 245 7.0E-23
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 19 245 4.0E-22
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 5 127 4.0E-22
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 19 221 5.0E-22
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 21 127 5.0E-22
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 20 144 8.0E-22
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 20 148 8.0E-22
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 20 135 1.0E-21
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 1 127 1.0E-21
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 20 144 2.0E-21
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 20 135 2.0E-21
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 3 127 8.0E-21
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 110 247 2.0E-20
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 110 247 2.0E-20
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 110 247 2.0E-20
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 110 244 3.0E-20
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 20 147 2.0E-19
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 110 250 4.0E-19
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 110 247 4.0E-19
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 19 126 5.0E-19
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 20 127 5.0E-19
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 19 126 6.0E-19
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 104 255 1.0E-18
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 114 246 2.0E-18
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 114 246 2.0E-18
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 143 260 2.0E-18
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 12 124 2.0E-18
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 110 247 2.0E-18
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 114 254 4.0E-18
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 8 253 4.0E-18
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 8 143 5.0E-18
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 20 143 5.0E-18
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 20 143 6.0E-18
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 143 260 6.0E-18
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 143 243 6.0E-18
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 143 260 8.0E-18
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 19 147 9.0E-18
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 114 258 1.0E-17
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 8 253 1.0E-17
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 19 134 1.0E-17
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 20 152 1.0E-17
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 143 243 2.0E-17
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 143 260 3.0E-17
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 19 127 3.0E-17
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 19 127 4.0E-17
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 19 134 4.0E-17
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 29 122 5.0E-17
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 19 134 5.0E-17
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 19 145 5.0E-17
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 18 124 8.0E-17
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 20 130 8.0E-17
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 27 132 1.0E-16
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 9 244 1.0E-16
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 26 130 2.0E-16
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 19 145 3.0E-16
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 19 147 3.0E-16
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 29 124 4.0E-16
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 3 147 4.0E-16
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 31 122 4.0E-16
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 120 246 5.0E-16
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 16 139 6.0E-16
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 118 261 6.0E-16
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 19 127 6.0E-16
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 142 245 7.0E-16
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 142 244 8.0E-16
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 20 127 8.0E-16
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 143 247 9.0E-16
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 143 248 1.0E-15
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 142 250 1.0E-15
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 3 126 1.0E-15
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 142 267 2.0E-15
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 27 126 2.0E-15
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 27 126 2.0E-15
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 27 126 2.0E-15
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 27 126 2.0E-15
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 27 126 2.0E-15
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 12 132 2.0E-15
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 27 136 3.0E-15
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 20 130 3.0E-15
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 20 126 4.0E-15
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 109 244 4.0E-15
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 143 255 4.0E-15
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 128 246 4.0E-15
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 12 124 4.0E-15
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 15 127 6.0E-15
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 90 245 7.0E-15
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 12 124 7.0E-15
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 120 257 8.0E-15
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 27 126 9.0E-15
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 143 261 1.0E-14
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 133 244 1.0E-14
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 18 153 1.0E-14
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 57 260 2.0E-14
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 143 247 2.0E-14
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 18 130 2.0E-14
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 18 130 2.0E-14
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 19 175 2.0E-14
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 29 126 2.0E-14
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 132 246 2.0E-14
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 18 130 3.0E-14
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 18 130 3.0E-14
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 16 126 3.0E-14
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 134 247 5.0E-14
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 128 246 5.0E-14
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 8 262 5.0E-14
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 31 129 5.0E-14
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 19 130 7.0E-14
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 16 295 8.0E-14
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 143 248 9.0E-14
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 142 248 1.0E-13
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 29 122 1.0E-13
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 142 247 1.0E-13
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 18 152 1.0E-13
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 17 193 2.0E-13
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 142 245 2.0E-13
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 142 245 2.0E-13
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 142 245 2.0E-13
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 142 245 2.0E-13
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 142 244 2.0E-13
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 142 244 3.0E-13
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 142 245 3.0E-13
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 142 244 3.0E-13
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 23 119 3.0E-13
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 27 133 4.0E-13
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 142 245 4.0E-13
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 134 247 4.0E-13
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 29 130 4.0E-13
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 57 244 4.0E-13
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 134 247 5.0E-13
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 20 122 5.0E-13
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 134 247 6.0E-13
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 5 131 6.0E-13
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 20 127 7.0E-13
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 27 133 8.0E-13
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 142 245 8.0E-13
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 14 295 8.0E-13
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 20 127 8.0E-13
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 27 133 1.0E-12
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 143 248 1.0E-12
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 134 247 1.0E-12
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 31 129 1.0E-12
sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 1 125 1.0E-12
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 116 246 2.0E-12
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 142 248 2.0E-12
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 142 247 2.0E-12
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 142 247 2.0E-12
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 20 127 2.0E-12
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 2 232 2.0E-12
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 8 221 2.0E-12
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 120 244 2.0E-12
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 8 221 2.0E-12
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 138 221 2.0E-12
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 133 3.0E-12
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 146 248 3.0E-12
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 18 126 3.0E-12
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 18 126 3.0E-12
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 2 232 3.0E-12
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 8 221 3.0E-12
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 19 147 3.0E-12
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 147 246 4.0E-12
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 128 244 5.0E-12
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 22 122 6.0E-12
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 143 244 7.0E-12
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 143 255 7.0E-12
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 2 232 7.0E-12
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 116 250 7.0E-12
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 141 228 7.0E-12
sp|Q3T0L2|ERP44_BOVIN Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 1 125 7.0E-12
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 142 247 8.0E-12
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 2 232 8.0E-12
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 15 126 9.0E-12
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 131 246 1.0E-11
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 143 270 1.0E-11
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 22 122 1.0E-11
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 147 245 1.0E-11
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 14 163 1.0E-11
sp|P30040|ERP29_HUMAN Endoplasmic reticulum resident protein 29 OS=Homo sapiens GN=ERP29 PE=1 SV=4 143 353 1.0E-11
sp|P57759|ERP29_MOUSE Endoplasmic reticulum resident protein 29 OS=Mus musculus GN=Erp29 PE=1 SV=2 143 353 1.0E-11
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 26 130 2.0E-11
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 147 245 2.0E-11
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 55 249 2.0E-11
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 141 228 2.0E-11
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 133 249 3.0E-11
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 27 122 4.0E-11
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 1 126 4.0E-11
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 159 356 5.0E-11
sp|P81623|ERP29_BOVIN Endoplasmic reticulum resident protein 29 OS=Bos taurus GN=ERP29 PE=1 SV=2 143 353 5.0E-11
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 27 122 6.0E-11
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 2 224 9.0E-11
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 23 124 9.0E-11
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 143 247 1.0E-10
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 8 232 1.0E-10
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 2 135 1.0E-10
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 143 283 2.0E-10
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 143 244 2.0E-10
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 30 105 2.0E-10
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 141 228 2.0E-10
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 143 247 3.0E-10
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 143 247 3.0E-10
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 17 126 3.0E-10
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 18 126 3.0E-10
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 144 247 3.0E-10
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 139 226 3.0E-10
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 159 247 4.0E-10
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 159 247 4.0E-10
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 159 248 4.0E-10
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 117 247 5.0E-10
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 25 118 5.0E-10
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 8 221 6.0E-10
sp|P52555|ERP29_RAT Endoplasmic reticulum resident protein 29 OS=Rattus norvegicus GN=Erp29 PE=1 SV=2 143 353 6.0E-10
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 141 228 6.0E-10
sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 135 247 9.0E-10
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 152 221 9.0E-10
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 26 122 1.0E-09
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 16 133 1.0E-09
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 129 229 1.0E-09
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 139 228 1.0E-09
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 24 100 1.0E-09
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 27 122 2.0E-09
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 27 122 2.0E-09
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 143 244 2.0E-09
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 26 142 2.0E-09
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 15 125 2.0E-09
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 139 245 2.0E-09
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 147 218 2.0E-09
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 141 228 2.0E-09
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 143 221 2.0E-09
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 27 122 3.0E-09
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 27 122 3.0E-09
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 143 246 3.0E-09
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 27 122 3.0E-09
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 139 229 3.0E-09
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 160 245 3.0E-09
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 27 122 4.0E-09
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 27 122 4.0E-09
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 24 112 4.0E-09
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 159 247 5.0E-09
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 140 226 5.0E-09
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 21 100 5.0E-09
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 23 124 5.0E-09
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 14 139 5.0E-09
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 18 97 5.0E-09
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 18 97 5.0E-09
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 27 126 6.0E-09
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 147 221 6.0E-09
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 18 111 7.0E-09
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 142 248 7.0E-09
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 12 78 7.0E-09
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 27 122 8.0E-09
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 27 122 8.0E-09
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 4 158 8.0E-09
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 39 139 8.0E-09
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 23 100 8.0E-09
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 8 106 9.0E-09
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 26 100 9.0E-09
sp|Q9Z7P5|THIO_CHLPN Thioredoxin OS=Chlamydia pneumoniae GN=trxA PE=3 SV=1 23 126 9.0E-09
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 27 105 1.0E-08
sp|P32474|EUG1_YEAST Protein disulfide-isomerase EUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EUG1 PE=1 SV=1 25 124 1.0E-08
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 148 226 1.0E-08
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 148 226 1.0E-08
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 143 241 2.0E-08
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 151 248 2.0E-08
sp|Q3T0L2|ERP44_BOVIN Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 135 247 2.0E-08
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 8 106 2.0E-08
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 20 127 2.0E-08
sp|P57653|THIO_BUCAI Thioredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxA PE=3 SV=1 143 249 2.0E-08
sp|Q3TMX7|QSOX2_MOUSE Sulfhydryl oxidase 2 OS=Mus musculus GN=Qsox2 PE=1 SV=1 142 227 2.0E-08
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 137 244 3.0E-08
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 146 246 3.0E-08
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 16 144 3.0E-08
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 27 122 3.0E-08
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 18 97 3.0E-08
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 140 245 3.0E-08
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 141 239 4.0E-08
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 120 185 4.0E-08
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 39 139 4.0E-08
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 147 245 4.0E-08
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 22 131 4.0E-08
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 20 122 4.0E-08
sp|Q6AUC6|QSOX1_ORYSJ Sulfhydryl oxidase 1 OS=Oryza sativa subsp. japonica GN=QSOX1 PE=2 SV=1 143 266 4.0E-08
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 16 144 5.0E-08
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 20 107 5.0E-08
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 4 136 5.0E-08
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 24 100 5.0E-08
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 140 228 5.0E-08
sp|Q99757|THIOM_HUMAN Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2 9 127 5.0E-08
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 25 122 5.0E-08
sp|Q8KE49|THIO2_CHLTE Thioredoxin-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx2 PE=3 SV=3 147 218 5.0E-08
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 23 123 5.0E-08
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 136 254 6.0E-08
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 147 241 6.0E-08
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 143 221 6.0E-08
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 143 221 6.0E-08
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 143 221 6.0E-08
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 143 221 6.0E-08
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 143 221 6.0E-08
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 143 221 6.0E-08
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 135 228 6.0E-08
sp|A3KPF5|PDI15_ARATH Protein disulfide isomerase-like 1-5 OS=Arabidopsis thaliana GN=PDIL1-5 PE=2 SV=1 20 127 6.0E-08
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 20 119 7.0E-08
sp|Q95108|THIOM_BOVIN Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2 9 127 7.0E-08
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 137 251 9.0E-08
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 160 244 9.0E-08
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 143 244 1.0E-07
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 23 100 1.0E-07
sp|Q95108|THIOM_BOVIN Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2 142 246 1.0E-07
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 25 97 1.0E-07
sp|Q17688|TXNDL_CAEEL Thioredoxin domain-containing protein C06A6.5 OS=Caenorhabditis elegans GN=C06A6.5 PE=1 SV=2 8 122 1.0E-07
sp|Q9ZU40|QSOX2_ARATH Sulfhydryl oxidase 2 OS=Arabidopsis thaliana GN=QSOX2 PE=2 SV=2 143 247 1.0E-07
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 159 237 1.0E-07
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 16 106 2.0E-07
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 160 243 2.0E-07
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 160 243 2.0E-07
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 146 229 2.0E-07
sp|Q99757|THIOM_HUMAN Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2 142 246 2.0E-07
sp|P97493|THIOM_MOUSE Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=1 SV=1 29 127 2.0E-07
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 33 122 2.0E-07
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 26 118 2.0E-07
sp|P97615|THIOM_RAT Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1 29 127 2.0E-07
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 18 97 2.0E-07
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 147 226 2.0E-07
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 24 100 2.0E-07
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 146 247 3.0E-07
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 142 246 3.0E-07
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 142 246 3.0E-07
sp|Q6H7E4|TRXM1_ORYSJ Thioredoxin M1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0639900 PE=2 SV=1 146 246 3.0E-07
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 18 122 3.0E-07
sp|Q6ZRP7|QSOX2_HUMAN Sulfhydryl oxidase 2 OS=Homo sapiens GN=QSOX2 PE=1 SV=3 142 227 3.0E-07
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 20 121 4.0E-07
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 23 100 4.0E-07
sp|P97493|THIOM_MOUSE Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=1 SV=1 142 246 4.0E-07
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 29 110 4.0E-07
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 148 228 4.0E-07
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 30 100 4.0E-07
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 24 100 4.0E-07
sp|Q66GQ3|PDI16_ARATH Protein disulfide isomerase-like 1-6 OS=Arabidopsis thaliana GN=PDIL1-6 PE=2 SV=1 20 133 4.0E-07
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 34 100 4.0E-07
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 20 132 5.0E-07
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 20 132 5.0E-07
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 20 124 5.0E-07
sp|P97615|THIOM_RAT Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1 142 246 5.0E-07
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 13 107 5.0E-07
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 143 229 5.0E-07
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 20 100 5.0E-07
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 20 100 5.0E-07
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 20 100 5.0E-07
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 20 100 5.0E-07
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 26 100 5.0E-07
sp|Q8LD49|TRXX_ARATH Thioredoxin X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2 13 100 5.0E-07
sp|O83889|THIO_TREPA Thioredoxin OS=Treponema pallidum (strain Nichols) GN=trxA PE=3 SV=1 159 228 5.0E-07
sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 138 241 5.0E-07
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 160 243 6.0E-07
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 17 100 6.0E-07
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 17 100 6.0E-07
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 17 100 6.0E-07
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 17 100 6.0E-07
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 17 100 6.0E-07
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 17 100 6.0E-07
sp|Q9ZU40|QSOX2_ARATH Sulfhydryl oxidase 2 OS=Arabidopsis thaliana GN=QSOX2 PE=2 SV=2 21 112 6.0E-07
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 21 100 6.0E-07
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 20 132 7.0E-07
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 37 107 7.0E-07
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 143 228 7.0E-07
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 143 228 7.0E-07
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 146 246 7.0E-07
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 146 246 7.0E-07
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 146 246 7.0E-07
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 146 246 7.0E-07
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 147 238 7.0E-07
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 146 244 7.0E-07
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 148 245 7.0E-07
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 24 103 8.0E-07
sp|Q9Z7P5|THIO_CHLPN Thioredoxin OS=Chlamydia pneumoniae GN=trxA PE=3 SV=1 142 226 8.0E-07
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 24 105 9.0E-07
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 24 105 9.0E-07
sp|P9WG67|THIO_MYCTU Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 24 100 9.0E-07
sp|P9WG66|THIO_MYCTO Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 24 100 9.0E-07
sp|P0A617|THIO_MYCBO Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 24 100 9.0E-07
sp|Q5UQN5|TR443_MIMIV Thioredoxin domain-containing protein R443 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R443 PE=1 SV=1 159 249 9.0E-07
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 147 221 1.0E-06
sp|Q6AUC6|QSOX1_ORYSJ Sulfhydryl oxidase 1 OS=Oryza sativa subsp. japonica GN=QSOX1 PE=2 SV=1 15 125 1.0E-06
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 27 100 1.0E-06
sp|Q17688|TXNDL_CAEEL Thioredoxin domain-containing protein C06A6.5 OS=Caenorhabditis elegans GN=C06A6.5 PE=1 SV=2 152 250 1.0E-06
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 140 218 1.0E-06
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 159 244 1.0E-06
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 37 100 1.0E-06
sp|P09856|TRXF_SPIOL Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 36 98 1.0E-06
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 24 97 1.0E-06
sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 9 98 1.0E-06
sp|Q9SEU8|TRXM2_ARATH Thioredoxin M2, chloroplastic OS=Arabidopsis thaliana GN=At4g03520 PE=1 SV=2 142 229 1.0E-06
sp|P96132|THIO_THIRO Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 15 97 1.0E-06
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 159 237 1.0E-06
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 147 227 1.0E-06
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 152 221 1.0E-06
sp|Q8W4J3|QSOX1_ARATH Sulfhydryl oxidase 1 OS=Arabidopsis thaliana GN=QSOX1 PE=2 SV=1 19 99 1.0E-06
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 27 97 2.0E-06
sp|Q3TMX7|QSOX2_MOUSE Sulfhydryl oxidase 2 OS=Mus musculus GN=Qsox2 PE=1 SV=1 5 106 2.0E-06
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 27 129 2.0E-06
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 20 100 2.0E-06
sp|Q8W4J3|QSOX1_ARATH Sulfhydryl oxidase 1 OS=Arabidopsis thaliana GN=QSOX1 PE=2 SV=1 143 246 2.0E-06
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 31 124 2.0E-06
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 146 222 2.0E-06
sp|P92979|APR1_ARATH 5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2 9 122 2.0E-06
sp|Q5WA72|PDI15_ORYSJ Protein disulfide isomerase-like 1-5 OS=Oryza sativa subsp. japonica GN=PDIL1-5 PE=2 SV=1 51 249 2.0E-06
sp|P29451|THIO_MACMU Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 159 237 2.0E-06
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 159 237 2.0E-06
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 17 100 3.0E-06
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 36 100 3.0E-06
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 146 246 3.0E-06
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 15 100 3.0E-06
sp|Q9BDJ3|THIO_CALJA Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 159 237 3.0E-06
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 38 97 3.0E-06
sp|O97680|THIO_BOVIN Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 159 237 3.0E-06
sp|Q92JR5|THIO_RICCN Thioredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxA PE=3 SV=1 142 227 3.0E-06
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 139 247 4.0E-06
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 24 97 4.0E-06
sp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2 15 98 4.0E-06
sp|Q9TW67|NGLY1_CAEEL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=png-1 PE=1 SV=1 159 247 4.0E-06
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 152 221 4.0E-06
sp|P52228|THIO3_CORNE Thioredoxin C-3 OS=Corynebacterium nephridii PE=3 SV=1 21 97 4.0E-06
sp|Q6JE38|CITX1_NICBE Thioredoxin-like protein CITRX1, chloroplastic OS=Nicotiana benthamiana GN=CITRX1 PE=2 SV=1 159 233 4.0E-06
sp|Q5R9M3|THIO_PONAB Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3 159 237 4.0E-06
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 139 243 5.0E-06
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 147 251 5.0E-06
sp|O83889|THIO_TREPA Thioredoxin OS=Treponema pallidum (strain Nichols) GN=trxA PE=3 SV=1 20 124 5.0E-06
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 148 246 5.0E-06
sp|P08629|THIO_CHICK Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 159 221 5.0E-06
sp|Q1RKN1|THIO_RICBR Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 147 245 5.0E-06
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 24 103 6.0E-06
sp|Q4L5F0|THIO_STAHJ Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 20 100 6.0E-06
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 146 225 7.0E-06
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 159 244 7.0E-06
sp|Q6ZRP7|QSOX2_HUMAN Sulfhydryl oxidase 2 OS=Homo sapiens GN=QSOX2 PE=1 SV=3 39 106 7.0E-06
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 159 261 7.0E-06
sp|O48897|TRXF_BRANA Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1 15 98 7.0E-06
sp|Q7XKD0|TRXX_ORYSJ Thioredoxin X, chloroplastic OS=Oryza sativa subsp. japonica GN=TRX-X PE=2 SV=1 146 242 7.0E-06
sp|O65049|TRXH_PICMA Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 153 232 7.0E-06
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 138 250 8.0E-06
sp|Q8KE49|THIO2_CHLTE Thioredoxin-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx2 PE=3 SV=3 24 97 8.0E-06
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 159 226 8.0E-06
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 26 100 8.0E-06
sp|P9WG67|THIO_MYCTU Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 147 246 9.0E-06
sp|P9WG66|THIO_MYCTO Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 147 246 9.0E-06
sp|P0A617|THIO_MYCBO Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 147 246 9.0E-06
sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1 16 100 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005783 endoplasmic reticulum Yes
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 155.85 84.95 226.76
Initials Initials knots 91.58 55.06 128.10
Pileal_Stipeal_center Stage I stipe center 196.00 113.06 278.94
Pileal_Stipeal_shell Stage I stipe shell 295.44 159.17 431.72
DIF_stipe_center Stage II stipe center 230.22 134.85 325.59
DIF_stipe_shell Stage II stipe shell 169.08 100.86 237.30
DIF_stipe_skin Stage II stipe skin 192.04 113.22 270.86
DIF_cap_skin Stage II cap skin 415.19 225.99 604.38
DIF_cap_tissue Stage II cap tissue 400.52 222.17 578.88
DIF_gill_tissue Stage II gill tissue 343.34 192.41 494.27
YFB_stipe_center Young fruiting body stipe center 223.01 122.01 324.00
YFB_stipe_shell Young fruiting body stipe shell 162.61 95.11 230.12
YFB_stipe_skin Young fruiting body stipe skin 176.98 102.91 251.05
YFB_cap_skin Young fruiting body cap skin 373.23 208.81 537.64
YFB_cap_tissue Young fruiting body cap tissue 361.09 202.18 520.00
YFB_gill_tissue Young fruiting body gill tissue 297.69 170.16 425.23
YFB_veil Young fruiting body veil 315.19 179.57 450.81

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.003365 yes
Casing YFB_stipe_center 0.288491 no
Casing YFB_stipe_shell 0.941584 no
Casing YFB_stipe_skin 0.781654 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.001140 yes
Casing YFB_gill_tissue 0.021846 yes
Casing YFB_veil 0.008121 yes
Casing Initials 0.062610 no
Casing Pileal_Stipeal_center 0.552015 no
Casing Pileal_Stipeal_shell 0.026461 yes
Casing DIF_stipe_center 0.214821 no
Casing DIF_stipe_shell 0.873326 no
Casing DIF_stipe_skin 0.603994 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.180324 no
DIF_gill_tissue YFB_stipe_shell 0.004928 yes
DIF_gill_tissue YFB_stipe_skin 0.018624 yes
DIF_gill_tissue YFB_cap_skin 0.878879 no
DIF_gill_tissue YFB_cap_tissue 0.932173 no
DIF_gill_tissue YFB_gill_tissue 0.762306 no
DIF_gill_tissue YFB_veil 0.871569 no
YFB_stipe_center YFB_stipe_shell 0.355017 no
YFB_stipe_center YFB_stipe_skin 0.543768 no
YFB_stipe_center YFB_cap_skin 0.093007 no
YFB_stipe_center YFB_cap_tissue 0.127636 no
YFB_stipe_center YFB_gill_tissue 0.423618 no
YFB_stipe_center YFB_veil 0.303082 no
YFB_stipe_shell YFB_stipe_skin 0.861769 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.001625 yes
YFB_stipe_shell YFB_gill_tissue 0.023933 yes
YFB_stipe_shell YFB_veil 0.011041 yes
YFB_stipe_skin YFB_cap_skin 0.004160 yes
YFB_stipe_skin YFB_cap_tissue 0.009446 yes
YFB_stipe_skin YFB_gill_tissue 0.067334 no
YFB_stipe_skin YFB_veil 0.034377 yes
YFB_cap_skin YFB_cap_tissue 0.954721 no
YFB_cap_skin YFB_gill_tissue 0.570335 no
YFB_cap_skin YFB_veil 0.698990 no
YFB_cap_tissue YFB_gill_tissue 0.644506 no
YFB_cap_tissue YFB_veil 0.771336 no
YFB_gill_tissue YFB_veil 0.915644 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.030610 yes
Initials YFB_stipe_skin 0.009446 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.003765 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.016104 yes
Initials DIF_stipe_skin 0.004548 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.055182 no
Pileal_Stipeal_center YFB_stipe_center 0.784425 no
Pileal_Stipeal_center YFB_stipe_shell 0.641252 no
Pileal_Stipeal_center YFB_stipe_skin 0.828864 no
Pileal_Stipeal_center YFB_cap_skin 0.022369 yes
Pileal_Stipeal_center YFB_cap_tissue 0.031557 yes
Pileal_Stipeal_center YFB_gill_tissue 0.171535 no
Pileal_Stipeal_center YFB_veil 0.104587 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.202683 no
Pileal_Stipeal_center DIF_stipe_center 0.701308 no
Pileal_Stipeal_center DIF_stipe_shell 0.730947 no
Pileal_Stipeal_center DIF_stipe_skin 0.971231 no
Pileal_Stipeal_center DIF_cap_skin 0.005671 yes
Pileal_Stipeal_center DIF_cap_tissue 0.010412 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.752248 no
Pileal_Stipeal_shell YFB_stipe_center 0.453844 no
Pileal_Stipeal_shell YFB_stipe_shell 0.035993 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.085220 no
Pileal_Stipeal_shell YFB_cap_skin 0.560882 no
Pileal_Stipeal_shell YFB_cap_tissue 0.640172 no
Pileal_Stipeal_shell YFB_gill_tissue 0.989164 no
Pileal_Stipeal_shell YFB_veil 0.906448 no
Pileal_Stipeal_shell DIF_stipe_center 0.504988 no
Pileal_Stipeal_shell DIF_stipe_shell 0.050294 no
Pileal_Stipeal_shell DIF_stipe_skin 0.170233 no
Pileal_Stipeal_shell DIF_cap_skin 0.340971 no
Pileal_Stipeal_shell DIF_cap_tissue 0.417847 no
DIF_stipe_center DIF_gill_tissue 0.213417 no
DIF_stipe_center YFB_stipe_center 0.956369 no
DIF_stipe_center YFB_stipe_shell 0.267165 no
DIF_stipe_center YFB_stipe_skin 0.449066 no
DIF_stipe_center YFB_cap_skin 0.103956 no
DIF_stipe_center YFB_cap_tissue 0.140560 no
DIF_stipe_center YFB_gill_tissue 0.478458 no
DIF_stipe_center YFB_veil 0.340799 no
DIF_stipe_center DIF_stipe_shell 0.343101 no
DIF_stipe_center DIF_stipe_skin 0.653180 no
DIF_stipe_center DIF_cap_skin 0.039390 yes
DIF_stipe_center DIF_cap_tissue 0.062610 no
DIF_stipe_shell DIF_gill_tissue 0.007782 yes
DIF_stipe_shell YFB_stipe_center 0.433140 no
DIF_stipe_shell YFB_stipe_shell 0.944105 no
DIF_stipe_shell YFB_stipe_skin 0.931310 no
DIF_stipe_shell YFB_cap_skin 0.002084 yes
DIF_stipe_shell YFB_cap_tissue 0.002084 yes
DIF_stipe_shell YFB_gill_tissue 0.041603 yes
DIF_stipe_shell YFB_veil 0.017783 yes
DIF_stipe_shell DIF_stipe_skin 0.775932 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.001625 yes
DIF_stipe_skin DIF_gill_tissue 0.041164 yes
DIF_stipe_skin YFB_stipe_center 0.734836 no
DIF_stipe_skin YFB_stipe_shell 0.685194 no
DIF_stipe_skin YFB_stipe_skin 0.867943 no
DIF_stipe_skin YFB_cap_skin 0.015819 yes
DIF_stipe_skin YFB_cap_tissue 0.023415 yes
DIF_stipe_skin YFB_gill_tissue 0.147141 no
DIF_stipe_skin YFB_veil 0.083501 no
DIF_stipe_skin DIF_cap_skin 0.004928 yes
DIF_stipe_skin DIF_cap_tissue 0.007439 yes
DIF_cap_skin DIF_gill_tissue 0.661997 no
DIF_cap_skin YFB_stipe_center 0.032266 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.001625 yes
DIF_cap_skin YFB_cap_skin 0.835476 no
DIF_cap_skin YFB_cap_tissue 0.771606 no
DIF_cap_skin YFB_gill_tissue 0.338323 no
DIF_cap_skin YFB_veil 0.449066 no
DIF_cap_skin DIF_cap_tissue 0.953149 no
DIF_cap_tissue DIF_gill_tissue 0.745713 no
DIF_cap_tissue YFB_stipe_center 0.047798 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.002525 yes
DIF_cap_tissue YFB_cap_skin 0.898801 no
DIF_cap_tissue YFB_cap_tissue 0.843597 no
DIF_cap_tissue YFB_gill_tissue 0.416361 no
DIF_cap_tissue YFB_veil 0.535545 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084560
MKLALFFISAFVTAVSASNVLDLDQSNFDKVVGKGKPALVEFFAPWCGHCKNLAPTYEQLADAFAHAKDKVIIAK
VDADGAGKPIGKKYDVKGYPTLKWFDAAGKDEKYESGRDLDSLADFVTQKSGVKSNIKPPPPPETTILDADNFDK
VVLNPTNNVLVSFTAPWCGHCKNLKPTYEQVAKTFNPEGNCIVANINADDEMNRDIAKKYDVSSFPTIKFFSADN
KDGIAYEGGRSEADLVKYLNEKCNTQRQVGGGLNEKAGRLPAFDALAHKFYAAAANSRQTILNEARTLAKIATHG
VDHYLKVMEKVVANGDGYVAKEMKRLGSLMGKGTLAQSKIDELQIKINVLRSFVEEPKAARDEAEL*
Coding >AgabiH97|084560
ATGAAGCTGGCTCTTTTCTTTATTTCGGCGTTCGTAACAGCTGTTTCTGCGTCGAATGTACTCGATTTGGACCAG
AGCAATTTTGATAAAGTTGTTGGAAAGGGTAAACCTGCTTTGGTCGAGTTCTTTGCTCCGTGGTGTGGACATTGC
AAGAACCTTGCGCCTACATATGAACAACTAGCAGACGCATTCGCCCACGCAAAAGACAAAGTTATCATCGCCAAA
GTAGACGCTGACGGTGCTGGAAAGCCGATAGGCAAAAAATATGATGTCAAGGGATATCCCACACTGAAATGGTTT
GATGCTGCTGGAAAAGACGAGAAATATGAAAGTGGCAGAGATCTTGACAGTTTGGCTGACTTTGTCACTCAAAAA
TCGGGTGTTAAATCTAATATTAAACCCCCTCCACCACCAGAGACAACTATTCTAGATGCTGATAATTTCGACAAA
GTAGTCCTGAACCCGACTAACAATGTTCTCGTGTCCTTTACCGCTCCTTGGTGTGGTCACTGCAAGAATCTCAAA
CCTACTTACGAACAAGTCGCGAAAACTTTCAACCCAGAAGGCAATTGCATTGTGGCCAACATTAACGCAGATGAC
GAGATGAACAGGGATATTGCGAAGAAATATGATGTCTCTAGTTTCCCTACAATCAAATTCTTCTCGGCAGATAAT
AAGGATGGTATCGCATATGAAGGAGGGAGGTCAGAAGCGGATCTCGTAAAGTACTTGAATGAAAAGTGTAACACA
CAACGACAAGTTGGTGGTGGCTTGAACGAAAAGGCTGGTCGCCTACCAGCGTTTGATGCACTTGCGCACAAGTTC
TATGCCGCTGCTGCAAATTCTCGTCAAACGATTCTGAATGAAGCGCGCACATTGGCTAAGATTGCTACCCATGGT
GTAGATCATTATTTGAAAGTCATGGAGAAAGTAGTGGCGAATGGTGATGGTTATGTCGCGAAAGAGATGAAGCGC
CTTGGCTCCCTTATGGGGAAAGGCACTCTTGCCCAATCTAAAATCGACGAACTTCAAATCAAGATCAACGTTCTT
CGCTCGTTTGTGGAGGAACCTAAGGCTGCTAGAGATGAAGCTGAGCTTTAA
Transcript >AgabiH97|084560
ATGAAGCTGGCTCTTTTCTTTATTTCGGCGTTCGTAACAGCTGTTTCTGCGTCGAATGTACTCGATTTGGACCAG
AGCAATTTTGATAAAGTTGTTGGAAAGGGTAAACCTGCTTTGGTCGAGTTCTTTGCTCCGTGGTGTGGACATTGC
AAGAACCTTGCGCCTACATATGAACAACTAGCAGACGCATTCGCCCACGCAAAAGACAAAGTTATCATCGCCAAA
GTAGACGCTGACGGTGCTGGAAAGCCGATAGGCAAAAAATATGATGTCAAGGGATATCCCACACTGAAATGGTTT
GATGCTGCTGGAAAAGACGAGAAATATGAAAGTGGCAGAGATCTTGACAGTTTGGCTGACTTTGTCACTCAAAAA
TCGGGTGTTAAATCTAATATTAAACCCCCTCCACCACCAGAGACAACTATTCTAGATGCTGATAATTTCGACAAA
GTAGTCCTGAACCCGACTAACAATGTTCTCGTGTCCTTTACCGCTCCTTGGTGTGGTCACTGCAAGAATCTCAAA
CCTACTTACGAACAAGTCGCGAAAACTTTCAACCCAGAAGGCAATTGCATTGTGGCCAACATTAACGCAGATGAC
GAGATGAACAGGGATATTGCGAAGAAATATGATGTCTCTAGTTTCCCTACAATCAAATTCTTCTCGGCAGATAAT
AAGGATGGTATCGCATATGAAGGAGGGAGGTCAGAAGCGGATCTCGTAAAGTACTTGAATGAAAAGTGTAACACA
CAACGACAAGTTGGTGGTGGCTTGAACGAAAAGGCTGGTCGCCTACCAGCGTTTGATGCACTTGCGCACAAGTTC
TATGCCGCTGCTGCAAATTCTCGTCAAACGATTCTGAATGAAGCGCGCACATTGGCTAAGATTGCTACCCATGGT
GTAGATCATTATTTGAAAGTCATGGAGAAAGTAGTGGCGAATGGTGATGGTTATGTCGCGAAAGAGATGAAGCGC
CTTGGCTCCCTTATGGGGAAAGGCACTCTTGCCCAATCTAAAATCGACGAACTTCAAATCAAGATCAACGTTCTT
CGCTCGTTTGTGGAGGAACCTAAGGCTGCTAGAGATGAAGCTGAGCTTTAA
Gene >AgabiH97|084560
ATGAAGCTGGCTCTTTTCTTTATTTCGGCGTTCGTAACAGCTGTTTCTGCGTCGAATGTACTCGATTTGGACCAG
AGCAATTTTGATAAAGTTGTTGGAAAGGGTAAACCTGCTTTGGTCGAGTTGTGCGTAACTCTTTGTTATTGAATG
CAACTTACCGTTGTTGACTTCCTTTTATATAGCTTTGCTCCGTGGTGGTACGCGTTCTTGTTTCTTTTCGATGTT
GTTGAATAACTTGGATGACCTTATATAACCACTTGTGTGCAGTGGACATTGCAAGGTATGTACTCGAACACATAT
CCATATATGAAAATTCTTATGAAAATAGAACCTTGCGCCTACATATGAACAACTAGCAGACGCATTCGCCCACGC
AAAAGACAAAGTTATCATCGCCAAAGTAGACGCTGACGGTGCTGGAAAGCCGATAGGCAAAAAATATGATGTCAA
GGGATATCCCAGTACGCCATTTCTAAATAAATTCAAACGTGTTTAGATTCGGTGGGTTTAACGTCGGCGTAAAAT
TCTAGCACTGAAATGGTTTGATGCTGCTGGAAAAGACGAGAAATATGAAAGTGGCAGAGATCTTGACAGTTTGGC
TGACTTGTGCGTTTTCGTCCGATTTCCTTTGAGGTTTTTGTTGACAATGGCGGATTTTTTTCTTTTTTACTAGTG
TCACTCAAAAATCGGGTGTTAAATCTAATATTAAACCCCCTCCACCACCAGAGACAACTATTCTAGATGCTGATA
ATTTCGACAAAGTAGTCCTGGTACGCACGCGTCTTTTGTGGATGTTTCTGTCTAAGCTAATGGCTGAGATTTGTG
TTTAGAACCCGACTAACAATGTTCTCGTGTCCTTTACCGTAAGCGCTGTTCTAGTTATGATTCGTGGTATGCGGG
TCACCATGTAACACTTCTTCGACGAATTAGGCTCCTTGGTGTGGTCACTGCAAGAATCTCAAACCTACTTACGAA
CAAGGTAGGTCTGGTAAAGGTCTATCCATACCCTCACATGGCTTAATATACGCTTCTTAGTCGCGAAAACTTTCA
ACCCAGAAGGCAATGTAAGCTTCTAAATCTCTCCTTACCCAAACTTGAAATGAACTCCCAACTTCTAGTGCATTG
TGGCCAACATTAACGCAGATGACGAGATGAACAGGGATATTGCGAAGAAATATGATGTCTCTAGTTTCCCTACAA
TCAAATTCTTCTCGGCAGATAATAAGGATGGTATCGCATATGAAGGAGGGAGGTCAGAAGCGGATCTCGTAAAGT
ACTTGAATGAAAAGTGTAACACACAACGACAAGTTGGTGGTGGCTTGAACGAAAAGGTACGCTTTCTTGGATGCT
TACTCACCGCGAGTAACGTGTTAACCATGTTTTATTCTCTCAAGGCTGGTCGCCTACCAGCGTTTGATGCACTTG
CGCACAAGTTCTATGCCGCTGCTGCAAATTCTCGTCAAACGATTCTGAATGAAGCGCGCACATTGGCTAAGATTG
CTACCCATGGTGTAGATCATTATTTGAAAGTCATGGAGAAAGTAGTGGCGAATGGTGATGGTTATGTCGCGAAAG
AGATGAAGCGGTACGTTTCATTGTTTCATTAACCGTGTACCATCAATATTTCGTTGACGCGGTTCATTCTTCTTA
GCCTTGGCTCCCTTATGGGGAAAGGCACTCTTGCCCAATCTAAAATCGACGAACTTCAAATCAAGATCAACGTTC
TTCGCTCGTTTGTGGAGGAACCTAAGGCTGCTAGAGATGAAGCTGAGCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail