Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084550
Gene name
Locationscaffold_5:1582386..1583728
Strand-
Gene length (bp)1342
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 1.3E-05 150 410

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084550
MMFNLHSRGMRVPFSDEPVTEPFIPPNPEDEMESCGLMDDGPVIPDFHSRPGGWHNYHQPGIPDVSHLSPNIPKK
AVVPSKNRPVIPTKQDMEWKSEESEWETPTSESRTFTLKMYRYRPRRKDWKHVSSPNRRPDFGRDEILPMSVRIL
TWNINCDRRVWQDRIEGALRHLEEIITRYKDEEQKNGHKGEACVIMLQEVTKDMLEQYIVMDKWVQSRFAVVPIE
HEKWPKQAYFGNVTLVSRDLDVHSAEIVHYGFSRNQRTGLVVRIRMSLTGKEDDSHVIVFGNTHLESLAAGEMLR
PGQLKDMADILKTEDVEGGVIAGDMNATDESDKVLGRKLGLKDAYKGKDSDPKGFTCGHYRLQKNDIPPGRLDRV
YYLPKRKYKVEEPAVFGKGLTVMTPEEEEHSLSDHAGLATVLHVTG*
Coding >AgabiH97|084550
ATGATGTTTAATCTGCATTCTCGAGGCATGCGAGTGCCTTTCTCTGACGAACCGGTTACGGAGCCCTTCATTCCT
CCCAACCCAGAGGATGAGATGGAGTCGTGTGGGCTCATGGACGACGGACCTGTGATACCTGATTTCCATTCACGG
CCAGGTGGATGGCATAACTACCACCAGCCAGGGATACCCGACGTCAGCCACCTGTCGCCTAATATCCCCAAGAAG
GCAGTCGTACCTTCTAAAAACCGTCCAGTCATACCAACCAAACAAGACATGGAATGGAAGTCTGAGGAATCGGAA
TGGGAAACTCCAACGAGCGAGAGTCGTACTTTTACTTTGAAGATGTACCGATATCGACCGAGACGTAAAGATTGG
AAACATGTTTCTTCTCCGAACAGAAGACCAGATTTCGGACGAGACGAGATTTTACCAATGTCCGTGCGGATCCTT
ACGTGGAATATTAACTGTGACAGGAGGGTCTGGCAAGATCGTATCGAAGGAGCGTTGCGTCACCTGGAGGAAATT
ATAACGAGATATAAAGACGAGGAACAAAAAAATGGGCACAAGGGAGAGGCGTGTGTGATTATGTTGCAAGAGGTT
ACGAAAGATATGCTCGAGCAATACATAGTGATGGACAAGTGGGTGCAAAGCAGGTTCGCCGTCGTTCCGATCGAA
CACGAGAAATGGCCCAAGCAAGCATATTTTGGAAACGTGACGTTGGTTTCGAGGGACTTGGATGTGCATAGTGCG
GAGATTGTCCATTATGGATTTTCGCGCAACCAGCGGACGGGTCTGGTTGTTCGAATACGGATGTCTTTGACGGGC
AAGGAGGACGATAGCCATGTCATCGTCTTTGGCAACACACACTTGGAATCGCTGGCAGCGGGGGAGATGCTGCGC
CCTGGACAGCTCAAAGACATGGCAGATATACTCAAAACAGAGGACGTGGAAGGAGGAGTGATTGCCGGAGACATG
AATGCGACTGACGAGTCGGACAAGGTGCTGGGACGTAAATTGGGCCTGAAGGATGCCTATAAGGGGAAAGATTCT
GATCCGAAGGGATTCACGTGTGGACACTACCGACTGCAGAAAAACGATATTCCGCCGGGGCGGTTGGACAGGGTA
TATTATCTACCAAAACGCAAGTACAAGGTGGAAGAGCCTGCAGTGTTTGGCAAGGGCCTCACGGTGATGACGCCG
GAGGAGGAGGAGCATTCGCTGTCAGACCACGCTGGCCTTGCGACGGTGTTGCACGTGACGGGATAG
Transcript >AgabiH97|084550
ATGATGTTTAATCTGCATTCTCGAGGCATGCGAGTGCCTTTCTCTGACGAACCGGTTACGGAGCCCTTCATTCCT
CCCAACCCAGAGGATGAGATGGAGTCGTGTGGGCTCATGGACGACGGACCTGTGATACCTGATTTCCATTCACGG
CCAGGTGGATGGCATAACTACCACCAGCCAGGGATACCCGACGTCAGCCACCTGTCGCCTAATATCCCCAAGAAG
GCAGTCGTACCTTCTAAAAACCGTCCAGTCATACCAACCAAACAAGACATGGAATGGAAGTCTGAGGAATCGGAA
TGGGAAACTCCAACGAGCGAGAGTCGTACTTTTACTTTGAAGATGTACCGATATCGACCGAGACGTAAAGATTGG
AAACATGTTTCTTCTCCGAACAGAAGACCAGATTTCGGACGAGACGAGATTTTACCAATGTCCGTGCGGATCCTT
ACGTGGAATATTAACTGTGACAGGAGGGTCTGGCAAGATCGTATCGAAGGAGCGTTGCGTCACCTGGAGGAAATT
ATAACGAGATATAAAGACGAGGAACAAAAAAATGGGCACAAGGGAGAGGCGTGTGTGATTATGTTGCAAGAGGTT
ACGAAAGATATGCTCGAGCAATACATAGTGATGGACAAGTGGGTGCAAAGCAGGTTCGCCGTCGTTCCGATCGAA
CACGAGAAATGGCCCAAGCAAGCATATTTTGGAAACGTGACGTTGGTTTCGAGGGACTTGGATGTGCATAGTGCG
GAGATTGTCCATTATGGATTTTCGCGCAACCAGCGGACGGGTCTGGTTGTTCGAATACGGATGTCTTTGACGGGC
AAGGAGGACGATAGCCATGTCATCGTCTTTGGCAACACACACTTGGAATCGCTGGCAGCGGGGGAGATGCTGCGC
CCTGGACAGCTCAAAGACATGGCAGATATACTCAAAACAGAGGACGTGGAAGGAGGAGTGATTGCCGGAGACATG
AATGCGACTGACGAGTCGGACAAGGTGCTGGGACGTAAATTGGGCCTGAAGGATGCCTATAAGGGGAAAGATTCT
GATCCGAAGGGATTCACGTGTGGACACTACCGACTGCAGAAAAACGATATTCCGCCGGGGCGGTTGGACAGGGTA
TATTATCTACCAAAACGCAAGTACAAGGTGGAAGAGCCTGCAGTGTTTGGCAAGGGCCTCACGGTGATGACGCCG
GAGGAGGAGGAGCATTCGCTGTCAGACCACGCTGGCCTTGCGACGGTGTTGCACGTGACGGGATAG
Gene >AgabiH97|084550
ATGGTACGCAAATCGACGTAGCTTCTGTGTGGCGTTGCCCTGATATCAAGTTTCTCATTTTTTTTTCACACGGCG
ATAGATGTTTAATCTGCATTCTCGAGGCATGCGAGTGCCTTTCTCTGACGAACCGGTTACGGAGCCCTTCATTCC
TCCCAACCCAGAGGATGAGATGGAGTCGTGTGGGCTCATGGACGACGGACCTGTGATACCTGATTTCCATTCACG
GCCAGGTGGATGGCATAACTACCACCAGCCAGGGATACCCGACGTCAGCCACCTGTCGCCTAATATCCCCAAGAA
GGCAGTCGTACCTTCTAAAAACCGTCCAGTCATACCAACCAAACAAGACATGGAATGGAAGTCTGAGGAATCGGA
ATGGGAAACTCCAACGAGCGAGAGTCGTACTTTTACTTTGAAGATGTACCGATATCGACCGAGACGTAAAGATTG
GAAACATGTTTCTTCTCCGAACAGAAGACCAGATTTCGGACGAGACGAGATTTTACCAATGTCCGTGCGGATCCT
TACGTGGAATATTAACTGTGACAGGAGGGTCTGGCAAGATCGTATCGAAGGAGCGTTGCGTCACCTGGAGGAAAT
TATAACGAGATATAAAGACGAGGAACAAAAAAATGGGCACAAGGGAGAGGCGTGTGTGATTATGTTGCAAGAGGT
TACGAAAGATATGCTCGAGCAATACATAGTGATGGACAAGTGGGTGCAAAGCAGGTTCGCCGTCGTTCCGATCGA
ACACGAGAAATGGCCCAAGCAAGCATATTTTGGAAACGTGACGTTGGTTTCGAGGGACTTGGATGTGCATAGTGC
GGAGATTGTCCATTATGGATTTTCGCGCAACCAGCGGACGGGTCTGGTTGTTCGAATACGGATGTCTTTGACGGG
CAAGGAGGACGATAGCCATGTCATCGTCTTTGGCAACACACACTTGGAATCGCTGGCAGCGGGGGAGATGCTGCG
CCCTGGACAGCTCAAAGACATGGCAGATATACTCAAAACAGAGGACGTGGAAGGAGGAGTGATTGCCGGAGACAT
GAATGCGACTGACGAGTCGGACAAGGTGCTGGGACGTAAATTGGGCCTGAAGGATGCCTATAAGGGGAAAGATTC
TGATCCGAAGGGATTCACGTGTGGACACTACCGACTGCAGAAAAACGATATTCCGCCGGGGCGGTTGGACAGGGT
ATATTATCTACCAAAACGCAAGTACAAGGTGGAAGAGCCTGCAGTGTTTGGCAAGGGCCTCACGGTGATGACGCC
GGAGGAGGAGGAGCATTCGCTGTCAGACCACGCTGGCCTTGCGACGGTGTTGCACGTGACGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail