Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084380
Gene name
Locationscaffold_5:1543651..1546680
Strand+
Gene length (bp)3029
Transcript length (bp)2793
Coding sequence length (bp)2793
Protein length (aa) 931

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 1.2E-13 505 537

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54HA4|GTAO_DICDI GATA zinc finger domain-containing protein 15 (Fragment) OS=Dictyostelium discoideum GN=gtaO PE=3 SV=1 503 549 1.0E-09
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 498 541 3.0E-09
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 505 542 6.0E-09
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 505 547 1.0E-08
sp|Q5KSV0|GTAK_DICDI GATA zinc finger domain-containing protein 11 OS=Dictyostelium discoideum GN=gtaK PE=2 SV=1 504 536 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54HA4|GTAO_DICDI GATA zinc finger domain-containing protein 15 (Fragment) OS=Dictyostelium discoideum GN=gtaO PE=3 SV=1 503 549 1.0E-09
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 498 541 3.0E-09
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 505 542 6.0E-09
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 505 547 1.0E-08
sp|Q5KSV0|GTAK_DICDI GATA zinc finger domain-containing protein 11 OS=Dictyostelium discoideum GN=gtaK PE=2 SV=1 504 536 2.0E-08
sp|P40209|GAT2_YEAST Protein GAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT2 PE=3 SV=1 487 556 2.0E-08
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 503 558 4.0E-08
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 503 537 5.0E-08
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 498 569 6.0E-08
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 475 535 7.0E-08
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 505 544 1.0E-07
sp|Q01371|WC1_NEUCR White collar 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-1 PE=1 SV=2 502 556 3.0E-07
sp|Q55EQ0|GTAF_DICDI GATA zinc finger domain-containing protein 6 OS=Dictyostelium discoideum GN=gtaF PE=3 SV=1 503 545 4.0E-07
sp|Q54TM6|GTAI_DICDI GATA zinc finger domain-containing protein 9 OS=Dictyostelium discoideum GN=gtaI PE=3 SV=1 503 536 4.0E-07
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 504 583 4.0E-07
sp|Q55GK0|GTAE_DICDI GATA zinc finger domain-containing protein 5 OS=Dictyostelium discoideum GN=gtaE PE=3 SV=1 493 538 6.0E-07
sp|Q550D5|GTAA_DICDI Transcription factor stalky OS=Dictyostelium discoideum GN=stkA PE=1 SV=1 505 559 2.0E-06
sp|Q6DBP8|GAT11_ARATH GATA transcription factor 11 OS=Arabidopsis thaliana GN=GATA11 PE=2 SV=1 489 538 3.0E-06
sp|Q9SKN6|GAT13_ARATH Putative GATA transcription factor 13 OS=Arabidopsis thaliana GN=GATA13 PE=3 SV=2 505 538 3.0E-06
sp|Q9FJ10|GAT16_ARATH GATA transcription factor 16 OS=Arabidopsis thaliana GN=GATA16 PE=2 SV=1 505 544 4.0E-06
sp|Q9LIB5|GAT17_ARATH GATA transcription factor 17 OS=Arabidopsis thaliana GN=GATA17 PE=2 SV=1 505 554 5.0E-06
sp|Q8LAU9|GATA1_ARATH GATA transcription factor 1 OS=Arabidopsis thaliana GN=GATA1 PE=2 SV=2 504 538 5.0E-06
sp|Q8LC59|GAT23_ARATH GATA transcription factor 23 OS=Arabidopsis thaliana GN=GATA23 PE=2 SV=2 505 538 5.0E-06
sp|Q9ZPX0|GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana GN=GATA20 PE=2 SV=2 504 540 6.0E-06
sp|Q9FH57|GATA5_ARATH GATA transcription factor 5 OS=Arabidopsis thaliana GN=GATA5 PE=2 SV=1 504 538 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0003677 DNA binding No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3337 0.9156 0.0253 0.0222 0.0742 0.0008 0.0652 0.0394 0.0171 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup4584
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|084380
Agaricus bisporus var bisporus H97 AgabiH97|084380 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|63_3

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084380
MDSYHHLLPKLGQTRCYWALLSTDLQFIYLDPVLAHHLEAEAESLVGNSLLSFVHPDEQASAKTDLRSVLESRTL
HGSVTRVRFSRLSKIRRQLGHTGPPQTWSEEDKLAVDANYMAVDIVINWAAEGLVLCFIHATVDLDPQSDNDELN
KSHWTNWCGTPYMPPEQIQLLFQRLLMCVPQQSPSNTHTRIFQILANQPRRQLLLSWPPDQGNGFTGRDFAKLVE
NAELAAGPQKGNDAKTSCTRRYRATQLMSPSLGEVESIFIPHGSVIFACHKVESSMRSTSTNSTPMEHQLAYDVD
NSPNYPPSSAPPYYDSSTSYSLNPTYNQGYLAHQSIPISRSPPTYPSSRWPQTHQNQNYSTTQPLPTQQHWTPSP
THTITSLPPHTHTSQSMSNNNNRPGPYSNTLTSGPSWQAPPGGYEVYRAPSPPGYGIYSSNVPRSTGGGNVGAGI
LPTATPLTGANLAQDVVPPPKRRISPGSVKGGGQYNPAISSGRGTGNRPSGILECSSCGATASPEWRKGPSGKKE
LCNACGLRYARSRAKKDGGAGGPGQGRKKKAEKVDVHEKAGHSHLVGGNGSSNGANYKRDIRIKHRGSPGGRMTP
PHATIAAAAGSPGYASTFMRRSFGSGSEYGTPGTPPSASGSESGQHGRGHYTAFAAGATGEAETQNGNTLTPSPS
PPAPASISVPSTSASGSLGLSTSGASTSTALSAASASTLTSTSALPQIESTQDNNFIHYHPPHPPPSQHHDREIP
SLSVHPHSYSHSQLHSPQGSQSHPPHFLPAGSISSTGHYVHTYTARPSPLSQANNIVTGPAAGPLTPLSVPHSAT
EGADGTDLSNGTQLPPLAYMDRLVGSNLGGGPNHANNVPSLGEVGGVKMEFSDKQVQGNGGGGNTEVGGGGTSVG
REPLTPLSAESPIGPGVGGRHGRRTVLGGQ*
Coding >AgabiH97|084380
ATGGACTCTTACCACCACCTTCTGCCAAAACTCGGCCAGACTCGCTGCTACTGGGCCCTTCTCTCCACTGACCTC
CAGTTCATCTATCTTGACCCTGTTCTTGCCCACCATCTCGAAGCAGAGGCAGAATCACTCGTCGGAAATTCTCTT
CTCTCCTTTGTCCATCCCGACGAACAGGCTTCTGCAAAGACCGACCTTCGAAGCGTTCTCGAAAGTCGCACACTC
CATGGCTCCGTCACCCGTGTCCGTTTCTCCCGTCTATCCAAGATTCGCCGCCAACTCGGCCATACAGGGCCTCCT
CAGACGTGGTCCGAAGAAGATAAATTAGCTGTAGACGCCAATTATATGGCTGTAGACATCGTCATTAATTGGGCC
GCTGAAGGCCTCGTCCTCTGCTTCATCCACGCTACAGTTGACCTCGATCCGCAAAGCGACAACGACGAACTTAAC
AAATCCCACTGGACAAACTGGTGCGGAACACCGTATATGCCTCCGGAACAAATCCAGCTCCTTTTTCAGCGCCTC
CTCATGTGTGTGCCGCAACAATCTCCGAGTAACACCCATACCAGAATATTCCAGATCCTGGCCAACCAACCTCGT
CGCCAACTACTCCTTTCATGGCCTCCGGATCAAGGTAATGGGTTTACAGGCAGGGACTTTGCCAAACTCGTGGAG
AATGCGGAACTGGCTGCTGGTCCACAAAAAGGTAACGATGCCAAAACGAGCTGCACACGCAGGTACAGGGCCACG
CAACTCATGTCTCCCTCACTTGGCGAGGTGGAGAGTATTTTTATACCGCATGGTTCTGTAATTTTTGCCTGCCAC
AAGGTAGAATCGTCTATGCGCAGCACGTCCACAAACTCGACTCCCATGGAGCACCAGCTGGCTTATGATGTCGAT
AATTCTCCAAATTACCCTCCGTCCTCGGCTCCGCCCTACTACGACTCCTCTACCTCCTACTCTCTCAATCCTACC
TACAATCAAGGGTATCTCGCTCATCAGTCTATTCCCATTTCACGGTCTCCTCCCACTTATCCTTCATCCCGATGG
CCTCAGACTCACCAAAATCAAAATTATTCTACAACTCAGCCACTCCCCACTCAACAACACTGGACTCCCAGCCCA
ACGCACACGATCACATCTTTGCCACCCCACACGCATACATCACAGTCTATGAGTAACAATAATAACCGTCCCGGG
CCCTACTCAAATACGCTAACATCCGGACCGTCCTGGCAGGCCCCTCCTGGAGGCTATGAGGTTTATCGGGCTCCC
TCTCCTCCTGGTTATGGAATCTATTCTTCAAATGTTCCAAGGAGCACCGGTGGCGGCAACGTGGGAGCGGGCATA
TTGCCCACTGCTACACCTCTGACGGGTGCAAATTTGGCTCAGGATGTTGTACCGCCACCCAAACGTCGTATCAGT
CCTGGGTCGGTCAAAGGCGGAGGTCAATACAACCCAGCCATAAGCAGCGGAAGAGGCACTGGGAATAGGCCATCG
GGTATTCTTGAGTGCTCCAGCTGTGGTGCAACTGCGAGCCCGGAGTGGAGGAAAGGTCCCTCGGGTAAGAAAGAG
CTATGCAATGCATGTGGTTTGCGATATGCCCGATCGCGGGCTAAAAAGGATGGGGGGGCTGGTGGTCCTGGCCAA
GGGCGCAAAAAGAAAGCGGAAAAAGTTGATGTGCACGAGAAAGCCGGCCACTCTCATCTCGTTGGAGGTAATGGA
AGTTCGAATGGCGCAAACTACAAACGAGATATCAGAATAAAACATAGGGGGAGCCCTGGTGGCAGGATGACACCT
CCCCATGCTACCATTGCTGCTGCCGCAGGTTCTCCCGGGTATGCTAGCACATTCATGCGCAGGAGCTTTGGTTCC
GGATCTGAATATGGCACGCCGGGGACCCCACCCAGCGCAAGTGGAAGCGAAAGTGGTCAACATGGACGTGGACAT
TATACTGCTTTTGCTGCAGGTGCCACTGGAGAGGCTGAGACCCAAAATGGGAACACGTTGACTCCCTCACCTTCA
CCCCCCGCTCCGGCTTCGATTTCTGTGCCGTCGACTTCGGCTTCTGGATCATTGGGTTTATCAACATCTGGCGCT
TCGACTTCGACTGCTCTTAGTGCTGCTAGTGCCTCTACTTTGACTTCGACTTCAGCGCTTCCTCAGATAGAGTCC
ACCCAAGATAACAACTTTATTCATTACCATCCTCCCCACCCTCCACCTTCTCAGCATCATGACCGGGAAATTCCG
TCTTTGAGTGTGCACCCCCATTCTTACTCCCATTCCCAGTTACATTCACCTCAAGGTTCTCAATCGCATCCGCCG
CATTTCCTACCTGCTGGCTCCATTAGCTCAACTGGACATTACGTCCATACATATACCGCAAGGCCGTCACCTCTA
TCGCAAGCTAACAACATCGTGACTGGACCTGCTGCTGGACCTCTGACACCGTTGTCGGTCCCACACTCGGCGACT
GAGGGGGCTGATGGGACTGATTTAAGCAATGGAACACAGTTGCCGCCTTTGGCTTATATGGACCGACTTGTCGGT
TCGAATTTGGGTGGTGGCCCTAACCATGCTAATAATGTTCCATCATTAGGGGAGGTCGGGGGCGTTAAAATGGAA
TTTAGCGACAAGCAAGTCCAAGGGAATGGAGGCGGTGGAAACACCGAGGTGGGAGGAGGCGGAACGAGTGTTGGA
AGGGAGCCGTTGACACCACTTAGCGCGGAGAGCCCGATTGGACCAGGGGTTGGAGGACGGCATGGGAGAAGGACG
GTTTTGGGTGGCCAATGA
Transcript >AgabiH97|084380
ATGGACTCTTACCACCACCTTCTGCCAAAACTCGGCCAGACTCGCTGCTACTGGGCCCTTCTCTCCACTGACCTC
CAGTTCATCTATCTTGACCCTGTTCTTGCCCACCATCTCGAAGCAGAGGCAGAATCACTCGTCGGAAATTCTCTT
CTCTCCTTTGTCCATCCCGACGAACAGGCTTCTGCAAAGACCGACCTTCGAAGCGTTCTCGAAAGTCGCACACTC
CATGGCTCCGTCACCCGTGTCCGTTTCTCCCGTCTATCCAAGATTCGCCGCCAACTCGGCCATACAGGGCCTCCT
CAGACGTGGTCCGAAGAAGATAAATTAGCTGTAGACGCCAATTATATGGCTGTAGACATCGTCATTAATTGGGCC
GCTGAAGGCCTCGTCCTCTGCTTCATCCACGCTACAGTTGACCTCGATCCGCAAAGCGACAACGACGAACTTAAC
AAATCCCACTGGACAAACTGGTGCGGAACACCGTATATGCCTCCGGAACAAATCCAGCTCCTTTTTCAGCGCCTC
CTCATGTGTGTGCCGCAACAATCTCCGAGTAACACCCATACCAGAATATTCCAGATCCTGGCCAACCAACCTCGT
CGCCAACTACTCCTTTCATGGCCTCCGGATCAAGGTAATGGGTTTACAGGCAGGGACTTTGCCAAACTCGTGGAG
AATGCGGAACTGGCTGCTGGTCCACAAAAAGGTAACGATGCCAAAACGAGCTGCACACGCAGGTACAGGGCCACG
CAACTCATGTCTCCCTCACTTGGCGAGGTGGAGAGTATTTTTATACCGCATGGTTCTGTAATTTTTGCCTGCCAC
AAGGTAGAATCGTCTATGCGCAGCACGTCCACAAACTCGACTCCCATGGAGCACCAGCTGGCTTATGATGTCGAT
AATTCTCCAAATTACCCTCCGTCCTCGGCTCCGCCCTACTACGACTCCTCTACCTCCTACTCTCTCAATCCTACC
TACAATCAAGGGTATCTCGCTCATCAGTCTATTCCCATTTCACGGTCTCCTCCCACTTATCCTTCATCCCGATGG
CCTCAGACTCACCAAAATCAAAATTATTCTACAACTCAGCCACTCCCCACTCAACAACACTGGACTCCCAGCCCA
ACGCACACGATCACATCTTTGCCACCCCACACGCATACATCACAGTCTATGAGTAACAATAATAACCGTCCCGGG
CCCTACTCAAATACGCTAACATCCGGACCGTCCTGGCAGGCCCCTCCTGGAGGCTATGAGGTTTATCGGGCTCCC
TCTCCTCCTGGTTATGGAATCTATTCTTCAAATGTTCCAAGGAGCACCGGTGGCGGCAACGTGGGAGCGGGCATA
TTGCCCACTGCTACACCTCTGACGGGTGCAAATTTGGCTCAGGATGTTGTACCGCCACCCAAACGTCGTATCAGT
CCTGGGTCGGTCAAAGGCGGAGGTCAATACAACCCAGCCATAAGCAGCGGAAGAGGCACTGGGAATAGGCCATCG
GGTATTCTTGAGTGCTCCAGCTGTGGTGCAACTGCGAGCCCGGAGTGGAGGAAAGGTCCCTCGGGTAAGAAAGAG
CTATGCAATGCATGTGGTTTGCGATATGCCCGATCGCGGGCTAAAAAGGATGGGGGGGCTGGTGGTCCTGGCCAA
GGGCGCAAAAAGAAAGCGGAAAAAGTTGATGTGCACGAGAAAGCCGGCCACTCTCATCTCGTTGGAGGTAATGGA
AGTTCGAATGGCGCAAACTACAAACGAGATATCAGAATAAAACATAGGGGGAGCCCTGGTGGCAGGATGACACCT
CCCCATGCTACCATTGCTGCTGCCGCAGGTTCTCCCGGGTATGCTAGCACATTCATGCGCAGGAGCTTTGGTTCC
GGATCTGAATATGGCACGCCGGGGACCCCACCCAGCGCAAGTGGAAGCGAAAGTGGTCAACATGGACGTGGACAT
TATACTGCTTTTGCTGCAGGTGCCACTGGAGAGGCTGAGACCCAAAATGGGAACACGTTGACTCCCTCACCTTCA
CCCCCCGCTCCGGCTTCGATTTCTGTGCCGTCGACTTCGGCTTCTGGATCATTGGGTTTATCAACATCTGGCGCT
TCGACTTCGACTGCTCTTAGTGCTGCTAGTGCCTCTACTTTGACTTCGACTTCAGCGCTTCCTCAGATAGAGTCC
ACCCAAGATAACAACTTTATTCATTACCATCCTCCCCACCCTCCACCTTCTCAGCATCATGACCGGGAAATTCCG
TCTTTGAGTGTGCACCCCCATTCTTACTCCCATTCCCAGTTACATTCACCTCAAGGTTCTCAATCGCATCCGCCG
CATTTCCTACCTGCTGGCTCCATTAGCTCAACTGGACATTACGTCCATACATATACCGCAAGGCCGTCACCTCTA
TCGCAAGCTAACAACATCGTGACTGGACCTGCTGCTGGACCTCTGACACCGTTGTCGGTCCCACACTCGGCGACT
GAGGGGGCTGATGGGACTGATTTAAGCAATGGAACACAGTTGCCGCCTTTGGCTTATATGGACCGACTTGTCGGT
TCGAATTTGGGTGGTGGCCCTAACCATGCTAATAATGTTCCATCATTAGGGGAGGTCGGGGGCGTTAAAATGGAA
TTTAGCGACAAGCAAGTCCAAGGGAATGGAGGCGGTGGAAACACCGAGGTGGGAGGAGGCGGAACGAGTGTTGGA
AGGGAGCCGTTGACACCACTTAGCGCGGAGAGCCCGATTGGACCAGGGGTTGGAGGACGGCATGGGAGAAGGACG
GTTTTGGGTGGCCAATGA
Gene >AgabiH97|084380
ATGGACTCTTACCACCACCTTCTGCCAAAACTCGGCCAGACTCGCTGCTGTACGTCTTTCTTTCTGCCCTGCTCG
TCTCATCTCACCCTTCCTAGACTGGGCCCTTCTCTCCACTGACCTCCAGTTCATCTATCTTGACCCTGTTCTTGC
CCACCATCTCGAAGCAGAGGCAGAATCACTCGTCGGAAATTCTCTTCTCTCCTTTGTCCATCCCGACGAACAGGC
TTCTGCAAAGACCGACCTTCGAAGCGTTCTCGAAAGTCGCACACTCCATGGCTCCGTCACCCGGTGCGTCATTTT
TTTCTCGCATCGCGTATACTCTTGTCTCACTCAGCGTATCTAGTGTCCGTTTCTCCCGTCTATCCAAGATTCGCC
GCCAACTCGGCCATACAGGGCCTCCTCAGACGTGGTCCGAAGAAGATAAATTAGCTGTAGACGCCAATTATATGG
CTGTAGACATCGTCATTAATTGGGCCGCTGAAGGCCTCGTCCTCTGCTTCATCCACGCTACAGTTGACCTCGATC
CGCAAAGCGACAACGACGAACTTAACAAATCCCACTGGACAAACTGGTGCGGAACACCGTATATGCCTCCGGAAC
AAATCCAGCTCCTTTTTCAGCGCCTCCTCATGTGTGTGCCGCAACAATCTCCGAGTAACACCCATACCAGAATAT
TCCAGATCCTGGCCAACCAACCTCGTCGCCAACTACTCCTTTCATGGCCTCCGGATCAAGGTAATGGGTTTACAG
GCAGGGACTTTGCCAAACTCGTGGAGAATGCGGAACTGGCTGCTGGTCCACAAAAAGGTAACGATGCCAAAACGA
GCTGCACACGCAGGTACAGGGCCACGCAACTCATGTCTCCCTCACTTGGCGAGGTGGAGAGTATTTTTATACCGC
ATGGTCCTTCTCCTTTCCTTTTCCCATTTCCCAGACGCGCTCACTGTGATTTTTTCCCTCTCATGCTAGGTTCTG
TAATTTTTGCCTGCCACAAGGTAGAATCGTCTATGCGCAGCACGTCCACAAACTCGACTCCCATGGAGCACCAGC
TGGCTTATGATGTCGATAATTCTCCAAATTACCCTCCGTCCTCGGCTCCGCCCTACTACGACTCCTCTACCTCCT
ACTCTCTCAATCCTACCTACAATCAAGGGTATCTCGCTCATCAGTCTATTCCCATTTCACGGTCTCCTCCCACTT
ATCCTTCATCCCGATGGCCTCAGACTCACCAAAATCAAAATTATTCTACAACTCAGCCACTCCCCACTCAACAAC
ACTGGACTCCCAGCCCAACGCACACGATCACATCTTTGCCACCCCACACGCATACATCACAGTCTATGAGTAACA
ATAATAACCGTCCCGGGCCCTACTCAAATACGCTAACATCCGGACCGTCCTGGCAGGCCCCTCCTGGAGGCTATG
AGGTTTATCGGGCTCCCTCTCCTCCTGGTTATGGAATCTATTCTTCAAATGTTCCAAGGAGCACCGGTGGCGGCA
ACGTGGGAGCGGGCATATTGCCCACTGCTACACCTCTGACGGGTGCAAATTTGGCTCAGGATGTTGTACCGCCAC
CCAAACGTCGTATCAGTCCTGGGTCGGTCAAAGGCGGAGGTCAATACAACCCAGCCATAAGCAGCGGAAGAGGCA
CTGGGAATAGGCCATCGGGTATTCTTGAGTGCTCCAGCTGTGGTGCAACTGCGAGCCCGGAGTGGAGGAAAGGTC
CCTCGGGTAAGAAAGAGCTATGCAATGCGTATGTCCCGTTTAGCATATCTTGATTATCTGATCTCTCACCGTCGT
TTGAATTCTTTTTTTTTGGCAGATGTGGTTTGCGATATGCCCGATCGCGGGCTAAAAAGGATGGGGGGGCTGGTG
GTCCTGGCCAAGGGCGCAAAAAGAAAGCGGAAAAAGTTGATGTGCACGAGAAAGCCGGCCACTCTCATCTCGTTG
GAGGTAATGGAAGTTCGAATGGCGCAAACTACAAACGAGATATCAGAATAAAACATAGGGGGAGCCCTGGTGGCA
GGATGACACCTCCCCATGCTACCATTGCTGCTGCCGCAGGTTCTCCCGGGTATGCTAGCACATTCATGCGCAGGA
GCTTTGGTTCCGGATCTGAATATGGCACGCCGGGGACCCCACCCAGCGCAAGTGGAAGCGAAAGTGGTCAACATG
GACGTGGACATTATACTGCTTTTGCTGCAGGTGCCACTGGAGAGGCTGAGACCCAAAATGGGAACACGTTGACTC
CCTCACCTTCACCCCCCGCTCCGGCTTCGATTTCTGTGCCGTCGACTTCGGCTTCTGGATCATTGGGTTTATCAA
CATCTGGCGCTTCGACTTCGACTGCTCTTAGTGCTGCTAGTGCCTCTACTTTGACTTCGACTTCAGCGCTTCCTC
AGATAGAGTCCACCCAAGATAACAACTTTATTCATTACCATCCTCCCCACCCTCCACCTTCTCAGCATCATGACC
GGGAAATTCCGTCTTTGAGTGTGCACCCCCATTCTTACTCCCATTCCCAGTTACATTCACCTCAAGGTTCTCAAT
CGCATCCGCCGCATTTCCTACCTGCTGGCTCCATTAGCTCAACTGGACATTACGTCCATACATATACCGCAAGGC
CGTCACCTCTATCGCAAGCTAACAACATCGTGACTGGACCTGCTGCTGGACCTCTGACACCGTTGTCGGTCCCAC
ACTCGGCGACTGAGGGGGCTGATGGGACTGATTTAAGCAATGGAACACAGTTGCCGCCTTTGGCTTATATGGACC
GACTTGTCGGTTCGAATTTGGGTGGTGGCCCTAACCATGCTAATAATGTTCCATCATTAGGGGAGGTCGGGGGCG
TTAAAATGGAATTTAGCGACAAGCAAGTCCAAGGGAATGGAGGCGGTGGAAACACCGAGGTGGGAGGAGGCGGAA
CGAGTGTTGGAAGGGAGCCGTTGACACCACTTAGCGCGGAGAGCCCGATTGGACCAGGGGTTGGAGGACGGCATG
GGAGAAGGACGGTTTTGGGTGGCCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail