Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084360
Gene name
Locationscaffold_5:1537844..1541125
Strand-
Gene length (bp)3281
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17285 PRMT5_TIM PRMT5 TIM barrel domain 2.5E-68 66 403
PF05185 PRMT5 PRMT5 arginine-N-methyltransferase 3.3E-65 417 579
PF17286 PRMT5_C PRMT5 oligomerisation domain 1.9E-53 582 760

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6YXZ7|ANM5_ORYSJ Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. japonica GN=PRMT5 PE=2 SV=1 159 750 5.0E-127
sp|A2X0Q3|ANM5_ORYSI Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. indica GN=PRMT5 PE=3 SV=2 159 750 1.0E-126
sp|P78963|SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb1 PE=1 SV=2 143 758 2.0E-124
sp|Q8GWT4|ANM15_ARATH Protein arginine N-methyltransferase 1.5 OS=Arabidopsis thaliana GN=PMRT15 PE=1 SV=2 163 754 5.0E-124
sp|Q6NUA1|ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis GN=prmt5 PE=1 SV=1 130 754 3.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6YXZ7|ANM5_ORYSJ Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. japonica GN=PRMT5 PE=2 SV=1 159 750 5.0E-127
sp|A2X0Q3|ANM5_ORYSI Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. indica GN=PRMT5 PE=3 SV=2 159 750 1.0E-126
sp|P78963|SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb1 PE=1 SV=2 143 758 2.0E-124
sp|Q8GWT4|ANM15_ARATH Protein arginine N-methyltransferase 1.5 OS=Arabidopsis thaliana GN=PMRT15 PE=1 SV=2 163 754 5.0E-124
sp|Q6NUA1|ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis GN=prmt5 PE=1 SV=1 130 754 3.0E-122
sp|Q8CIG8|ANM5_MOUSE Protein arginine N-methyltransferase 5 OS=Mus musculus GN=Prmt5 PE=1 SV=3 115 750 3.0E-122
sp|Q5R698|ANM5_PONAB Protein arginine N-methyltransferase 5 OS=Pongo abelii GN=PRMT5 PE=2 SV=3 115 750 6.0E-121
sp|O14744|ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 115 750 2.0E-120
sp|Q4R5M3|ANM5_MACFA Protein arginine N-methyltransferase 5 OS=Macaca fascicularis GN=PRMT5 PE=2 SV=3 115 750 2.0E-120
sp|A7YW45|ANM5_BOVIN Protein arginine N-methyltransferase 5 OS=Bos taurus GN=PRMT5 PE=2 SV=1 130 750 7.0E-120
sp|Q54KI3|ANM5_DICDI Protein arginine N-methyltransferase 5 OS=Dictyostelium discoideum GN=prmt5 PE=3 SV=1 167 750 5.0E-102
sp|P38274|HSL7_YEAST Protein arginine N-methyltransferase HSL7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL7 PE=1 SV=1 162 793 1.0E-85
sp|Q9U6Y9|ANM5_DROME Protein arginine N-methyltransferase 5 OS=Drosophila melanogaster GN=csul PE=1 SV=2 294 752 4.0E-73
sp|P46580|ANM5_CAEEL Protein arginine N-methyltransferase 5 OS=Caenorhabditis elegans GN=prmt-5 PE=1 SV=2 297 753 3.0E-61
sp|Q86X55|CARM1_HUMAN Histone-arginine methyltransferase CARM1 OS=Homo sapiens GN=CARM1 PE=1 SV=3 445 747 2.0E-14
sp|Q9WVG6|CARM1_MOUSE Histone-arginine methyltransferase CARM1 OS=Mus musculus GN=Carm1 PE=1 SV=2 445 747 2.0E-14
sp|Q4AE70|CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus GN=Carm1 PE=1 SV=1 445 747 3.0E-14
sp|Q5XK84|CARM1_XENLA Histone-arginine methyltransferase CARM1 OS=Xenopus laevis GN=carm1 PE=2 SV=1 445 747 5.0E-14
sp|Q6DC04|CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio GN=carm1 PE=2 SV=1 445 747 3.0E-13
sp|Q7Q2B7|CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae GN=CARM1 PE=1 SV=5 445 747 5.0E-13
sp|B4QVW6|CARM1_DROSI Histone-arginine methyltransferase CARMER OS=Drosophila simulans GN=Art4 PE=3 SV=1 445 787 7.0E-13
sp|B3P4N5|CARM1_DROER Histone-arginine methyltransferase CARMER OS=Drosophila erecta GN=Art4 PE=3 SV=1 445 787 7.0E-13
sp|Q9VH48|CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster GN=Art4 PE=1 SV=1 445 787 7.0E-13
sp|B4HJC0|CARM1_DROSE Histone-arginine methyltransferase CARMER OS=Drosophila sechellia GN=Art4 PE=3 SV=1 445 787 8.0E-13
sp|B4PVH6|CARM1_DROYA Histone-arginine methyltransferase CARMER OS=Drosophila yakuba GN=Art4 PE=3 SV=1 445 787 8.0E-13
sp|B3M1E1|CARM1_DROAN Histone-arginine methyltransferase CARMER OS=Drosophila ananassae GN=Art4 PE=3 SV=1 445 787 1.0E-12
sp|B4KA23|CARM1_DROMO Histone-arginine methyltransferase CARMER OS=Drosophila mojavensis GN=Art4 PE=3 SV=1 445 787 2.0E-12
sp|Q29B63|CARM1_DROPS Histone-arginine methyltransferase CARMER OS=Drosophila pseudoobscura pseudoobscura GN=Art4 PE=3 SV=1 445 787 2.0E-12
sp|B4GZ20|CARM1_DROPE Histone-arginine methyltransferase CARMER OS=Drosophila persimilis GN=Art4 PE=3 SV=1 445 787 2.0E-12
sp|B0W3L6|CARM1_CULQU Histone-arginine methyltransferase CARMER OS=Culex quinquefasciatus GN=Art4 PE=3 SV=1 445 747 2.0E-12
sp|B4NKI9|CARM1_DROWI Histone-arginine methyltransferase CARMER OS=Drosophila willistoni GN=Art4 PE=3 SV=1 445 787 2.0E-12
sp|B4JXV2|CARM1_DROGR Histone-arginine methyltransferase CARMER OS=Drosophila grimshawi GN=Art4 PE=3 SV=1 445 787 3.0E-12
sp|B4LVS8|CARM1_DROVI Histone-arginine methyltransferase CARMER OS=Drosophila virilis GN=Art4 PE=3 SV=1 445 787 4.0E-12
sp|Q174R2|CARM1_AEDAE Histone-arginine methyltransferase CARMER OS=Aedes aegypti GN=CARM1 PE=3 SV=1 445 747 1.0E-11
sp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. indica GN=PRMT6.1 PE=3 SV=1 444 596 4.0E-09
sp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. japonica GN=PRMT6.1 PE=3 SV=2 444 596 5.0E-09
sp|Q08A71|ANM6_ARATH Probable protein arginine N-methyltransferase 6 OS=Arabidopsis thaliana GN=PRMT6 PE=2 SV=1 449 599 1.0E-07
sp|Q75G68|ANM62_ORYSJ Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. japonica GN=PRMT6.2 PE=2 SV=1 449 599 4.0E-07
sp|A2Z8S0|ANM62_ORYSI Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. indica GN=PRMT6.2 PE=3 SV=2 449 599 4.0E-07
sp|B3DLB3|ANM2_XENTR Protein arginine N-methyltransferase 2 OS=Xenopus tropicalis GN=prmt2 PE=2 SV=1 480 737 1.0E-06
sp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. japonica GN=PRMT10 PE=2 SV=1 450 598 1.0E-06
sp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. indica GN=PRMT10 PE=3 SV=1 450 598 1.0E-06
sp|Q6NWG4|ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio GN=prmt6 PE=2 SV=2 450 731 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084360
MAQWHHSPSAGLATVFTLDDILRASVSFISPSPSADASTHSHLPHAQKEQPDTPVLRLVKEARNKGYETICLPLT
TQNWRDRWEGMCLLPSSPAQASALESDKVEKTGENLDDFGAAHLTIDAEKKKKDRATAAEQWRARPGFLQDEVTI
TRIDEAEGITLMISDWLELDAEDDGIRHDAEIALQQELAYASYLHIQTAILPAPRNRSHVASYARVVNNCLKNTP
YIYLSVRLPIYNPTILHTQAAPPVQSYAGPGLGISPDVANASSSSLPSLLVSPVPSSPSGSASSEGEMNATWEMW
DVIRSICDYNTRLTLTLDLTPPLPSKLGVLSKWAAESVRYIFLPASTFIANTKGYPVLPKPTQDFIRDCMIHRPT
VILADVITNKHSRGGEVAYSQYVKFLEKTSAVVRNAHQSGTVEHFAQGYQDYLQAPLQPLMDNLQSMTYQTFEQD
PVKYERYEEAIFRALQEWPPGQRVVCCIAGAGRGPLVTRCLSAIDRCKRDVSVYAVEKNPNAYVTLQQRKVREWG
DRVKLLFGDMRLLEVPEPVDILISELLGSFGDNELSPECLDGAQRFLKPTGISIPSSYTAHLAPLSSSKLYNEAR
SGKNAQSLETPYVVMFQAVNILSGDKQEPGGRCGPQIQECWEFEHPRKDVILNTQGTPLTNNHNVRSARLRFWIP
HAGVLHGLAGYFEAILYGNVGLSIHPHRKDVVSKDMLSWFPLFFPFKEPLYLPSGSELQVSIWRLTNERQVWYEW
HAESFLMIMTTPGGKDELSMYSGGRQNLPSPTTIPSPLADDDAFFRTPAQSQKHLSQRAASLGGGAVGSGYRASI
RPWDLN*
Coding >AgabiH97|084360
ATGGCACAATGGCATCACTCTCCTTCAGCCGGCCTCGCAACTGTCTTCACGTTGGACGATATCCTCCGTGCCTCA
GTATCTTTCATTTCACCCAGTCCGTCCGCCGATGCATCCACTCATTCACATCTTCCACACGCCCAAAAGGAACAA
CCGGACACCCCAGTTTTACGGCTGGTAAAAGAAGCCAGGAATAAAGGCTACGAAACAATCTGTCTCCCTCTGACA
ACCCAAAATTGGAGGGATCGGTGGGAGGGCATGTGTTTATTGCCTAGCTCTCCCGCTCAAGCTTCGGCTCTCGAA
AGTGACAAAGTCGAGAAAACGGGCGAGAACCTGGATGACTTTGGAGCCGCCCATTTGACAATTGACGCTGAAAAG
AAGAAAAAAGATCGGGCGACAGCTGCAGAACAATGGCGTGCCAGACCTGGATTCTTGCAGGACGAAGTGACTATC
ACCAGGATAGACGAAGCTGAGGGTATCACACTTATGATATCTGATTGGCTTGAGCTTGACGCTGAGGACGATGGA
ATTCGTCACGACGCTGAAATTGCTTTGCAGCAAGAATTGGCGTATGCCTCTTATCTCCATATCCAAACCGCGATT
CTTCCTGCGCCGCGGAACAGATCTCATGTGGCGTCGTATGCCCGTGTAGTAAACAACTGTCTCAAAAACACACCG
TACATCTACCTGTCTGTCCGTCTTCCTATATACAACCCCACCATTTTACACACACAAGCCGCTCCACCTGTACAA
TCCTACGCAGGTCCTGGCCTCGGGATATCACCCGACGTGGCTAATGCTTCATCATCGTCCTTACCTTCACTGCTC
GTCTCCCCAGTCCCATCGTCGCCTTCAGGTTCTGCTTCTTCCGAGGGAGAGATGAATGCCACTTGGGAAATGTGG
GATGTCATAAGATCGATTTGTGATTATAATACTCGATTAACCCTGACGCTCGACTTGACTCCGCCTCTCCCATCC
AAGCTAGGTGTTTTAAGTAAATGGGCGGCTGAATCGGTCAGGTACATCTTCCTTCCGGCCTCTACATTCATCGCA
AACACAAAAGGGTATCCCGTCCTCCCAAAACCCACACAAGATTTCATTCGGGACTGTATGATTCATCGGCCAACT
GTAATACTTGCGGATGTCATCACGAATAAACATTCACGCGGGGGTGAAGTTGCTTATTCCCAGTATGTTAAGTTC
TTGGAGAAGACGAGTGCAGTCGTACGGAACGCACATCAATCGGGAACTGTCGAACATTTTGCTCAGGGATATCAA
GATTACTTACAGGCCCCATTGCAGCCATTAATGGATAACCTGCAAAGTATGACTTATCAGACGTTTGAGCAGGAT
CCTGTCAAGTATGAGAGGTATGAGGAGGCAATTTTCAGAGCACTCCAGGAGTGGCCACCTGGACAACGAGTAGTT
TGTTGTATAGCGGGTGCAGGTCGCGGGCCACTTGTGACAAGATGTCTGAGTGCAATTGACCGTTGTAAAAGAGAT
GTCTCCGTTTATGCGGTAGAAAAAAACCCGAATGCCTATGTTACATTACAACAGAGGAAAGTTCGAGAGTGGGGT
GATAGGGTCAAATTGCTGTTTGGCGATATGAGGCTGCTAGAGGTACCCGAACCTGTTGACATTCTGATTAGCGAA
TTACTGGGATCTTTTGGGGACAATGAGCTCAGTCCGGAATGCTTGGATGGTGCACAGCGCTTTTTAAAGCCGACG
GGAATTTCGATCCCTTCCTCCTATACGGCGCATCTAGCTCCTCTTTCATCTTCAAAGTTGTACAATGAAGCAAGA
TCAGGGAAAAACGCGCAGTCACTAGAAACTCCCTATGTAGTCATGTTCCAGGCTGTCAATATCCTTAGTGGAGAC
AAACAGGAGCCAGGCGGGAGGTGTGGCCCTCAAATTCAAGAGTGCTGGGAATTCGAGCATCCAAGGAAGGATGTG
ATCCTGAATACGCAGGGAACTCCTTTGACCAACAATCATAATGTTCGGTCCGCTAGGCTGAGGTTCTGGATTCCC
CATGCGGGTGTATTGCACGGTCTGGCTGGTTATTTTGAAGCAATTCTGTATGGAAACGTTGGGTTGAGCATTCAT
CCACATAGAAAGGATGTAGTATCGAAGGATATGTTGAGCTGGTTTCCCCTCTTCTTTCCGTTCAAGGAGCCGCTA
TATCTCCCGAGCGGATCTGAGTTACAGGTATCTATTTGGCGGTTAACAAATGAACGACAGGTGTGGTATGAATGG
CACGCAGAGTCGTTTTTGATGATTATGACCACTCCTGGAGGAAAGGATGAACTATCGATGTATTCCGGTGGAAGG
CAGAACTTGCCTTCTCCGACGACCATTCCAAGTCCTCTTGCCGATGACGATGCTTTCTTCAGGACACCTGCTCAG
TCACAAAAACACCTATCACAAAGGGCTGCATCGTTAGGAGGTGGAGCAGTTGGATCGGGCTATAGGGCGAGCATT
CGGCCTTGGGATTTGAATTAG
Transcript >AgabiH97|084360
ATGGCACAATGGCATCACTCTCCTTCAGCCGGCCTCGCAACTGTCTTCACGTTGGACGATATCCTCCGTGCCTCA
GTATCTTTCATTTCACCCAGTCCGTCCGCCGATGCATCCACTCATTCACATCTTCCACACGCCCAAAAGGAACAA
CCGGACACCCCAGTTTTACGGCTGGTAAAAGAAGCCAGGAATAAAGGCTACGAAACAATCTGTCTCCCTCTGACA
ACCCAAAATTGGAGGGATCGGTGGGAGGGCATGTGTTTATTGCCTAGCTCTCCCGCTCAAGCTTCGGCTCTCGAA
AGTGACAAAGTCGAGAAAACGGGCGAGAACCTGGATGACTTTGGAGCCGCCCATTTGACAATTGACGCTGAAAAG
AAGAAAAAAGATCGGGCGACAGCTGCAGAACAATGGCGTGCCAGACCTGGATTCTTGCAGGACGAAGTGACTATC
ACCAGGATAGACGAAGCTGAGGGTATCACACTTATGATATCTGATTGGCTTGAGCTTGACGCTGAGGACGATGGA
ATTCGTCACGACGCTGAAATTGCTTTGCAGCAAGAATTGGCGTATGCCTCTTATCTCCATATCCAAACCGCGATT
CTTCCTGCGCCGCGGAACAGATCTCATGTGGCGTCGTATGCCCGTGTAGTAAACAACTGTCTCAAAAACACACCG
TACATCTACCTGTCTGTCCGTCTTCCTATATACAACCCCACCATTTTACACACACAAGCCGCTCCACCTGTACAA
TCCTACGCAGGTCCTGGCCTCGGGATATCACCCGACGTGGCTAATGCTTCATCATCGTCCTTACCTTCACTGCTC
GTCTCCCCAGTCCCATCGTCGCCTTCAGGTTCTGCTTCTTCCGAGGGAGAGATGAATGCCACTTGGGAAATGTGG
GATGTCATAAGATCGATTTGTGATTATAATACTCGATTAACCCTGACGCTCGACTTGACTCCGCCTCTCCCATCC
AAGCTAGGTGTTTTAAGTAAATGGGCGGCTGAATCGGTCAGGTACATCTTCCTTCCGGCCTCTACATTCATCGCA
AACACAAAAGGGTATCCCGTCCTCCCAAAACCCACACAAGATTTCATTCGGGACTGTATGATTCATCGGCCAACT
GTAATACTTGCGGATGTCATCACGAATAAACATTCACGCGGGGGTGAAGTTGCTTATTCCCAGTATGTTAAGTTC
TTGGAGAAGACGAGTGCAGTCGTACGGAACGCACATCAATCGGGAACTGTCGAACATTTTGCTCAGGGATATCAA
GATTACTTACAGGCCCCATTGCAGCCATTAATGGATAACCTGCAAAGTATGACTTATCAGACGTTTGAGCAGGAT
CCTGTCAAGTATGAGAGGTATGAGGAGGCAATTTTCAGAGCACTCCAGGAGTGGCCACCTGGACAACGAGTAGTT
TGTTGTATAGCGGGTGCAGGTCGCGGGCCACTTGTGACAAGATGTCTGAGTGCAATTGACCGTTGTAAAAGAGAT
GTCTCCGTTTATGCGGTAGAAAAAAACCCGAATGCCTATGTTACATTACAACAGAGGAAAGTTCGAGAGTGGGGT
GATAGGGTCAAATTGCTGTTTGGCGATATGAGGCTGCTAGAGGTACCCGAACCTGTTGACATTCTGATTAGCGAA
TTACTGGGATCTTTTGGGGACAATGAGCTCAGTCCGGAATGCTTGGATGGTGCACAGCGCTTTTTAAAGCCGACG
GGAATTTCGATCCCTTCCTCCTATACGGCGCATCTAGCTCCTCTTTCATCTTCAAAGTTGTACAATGAAGCAAGA
TCAGGGAAAAACGCGCAGTCACTAGAAACTCCCTATGTAGTCATGTTCCAGGCTGTCAATATCCTTAGTGGAGAC
AAACAGGAGCCAGGCGGGAGGTGTGGCCCTCAAATTCAAGAGTGCTGGGAATTCGAGCATCCAAGGAAGGATGTG
ATCCTGAATACGCAGGGAACTCCTTTGACCAACAATCATAATGTTCGGTCCGCTAGGCTGAGGTTCTGGATTCCC
CATGCGGGTGTATTGCACGGTCTGGCTGGTTATTTTGAAGCAATTCTGTATGGAAACGTTGGGTTGAGCATTCAT
CCACATAGAAAGGATGTAGTATCGAAGGATATGTTGAGCTGGTTTCCCCTCTTCTTTCCGTTCAAGGAGCCGCTA
TATCTCCCGAGCGGATCTGAGTTACAGGTATCTATTTGGCGGTTAACAAATGAACGACAGGTGTGGTATGAATGG
CACGCAGAGTCGTTTTTGATGATTATGACCACTCCTGGAGGAAAGGATGAACTATCGATGTATTCCGGTGGAAGG
CAGAACTTGCCTTCTCCGACGACCATTCCAAGTCCTCTTGCCGATGACGATGCTTTCTTCAGGACACCTGCTCAG
TCACAAAAACACCTATCACAAAGGGCTGCATCGTTAGGAGGTGGAGCAGTTGGATCGGGCTATAGGGCGAGCATT
CGGCCTTGGGATTTGAATTAG
Gene >AgabiH97|084360
ATGGCACAATGGCATCACTCTCCTTCAGCCGGCCTCGCAACTGTCTTCACGTTGGACGATATCCTCCGTGCCTCA
GTATCTTTCATTTCACCCAGTCCGTCCGCCGATGCATCCACTCATTCACATCTTCCACACGCCCAAAAGGAACAA
CCGGACACCCCAGTTTTACGGCTGGTAAAAGAAGCCAGGAATAAAGGCTACGAAACAATCTGTCTCCCTCTGACA
ACCCAAAATTGGAGGGATCGGTGGGAGGGCATGTGTTTATTGCCTAGCTCTCCCGCTCAAGCTTCGGCTCTCGAA
AGTGACAAAGTCGAGAAAACGGGCGAGAACCTGGATGACTTTGGAGCCGCCCATTTGACAATTGACGCTGAAAAG
AAGAAAAAAGATCGGGCGACAGCTGCAGAACAATGGCGTGCCAGACCTGGATTCTTGCAGGACGAAGTGACTATC
ACCAGGATAGACGAAGCTGAGGGTATCACACTTATGATATCTGATTGGCTTGAGCTTGACGCTGAGGACGATGGA
ATTCGTCACGACGCTGAAATTGTATTGTCTTCCTGTCTTCCTGTGTTTCTGTTTCTGATGTATCTTCACCTGACA
GGCTTTGCAGCAAGAATTGGCGTATGCCTCTTATCTCCATATCCAAACCGCGATTCTTCCTGCGCCGCGGAACAG
ATCTCATGTGGCGTCGTATGCCCGTGTAGTAAACAACTGTCTCAAAAACACACCGTACATCTACCTGTCTGTCCG
TCTTCCTATATACAACCCCACCATTTTACACACACAAGCCGCTCCACCTGTACAATCCTACGCAGGTCCTGGCCT
CGGGATATCACCCGACGTGGCTAATGCTTCATCATCGTCCTTACCTTCACTGCTCGTCTCCCCAGTCCCATCGTC
GCCTTCAGGTTCTGCTTCTTCCGAGGGAGAGATGAATGCCACTTGGGAAATGTGGGATGTCATAAGATCGATTTG
TGATTATAATACTCGATTAACCCTGAGTGCGTTTTTCTATACTTATAGTCCAAATGCAGTTGTCCATGACGATTT
GTAGCGCTCGACTTGACTCCGCCTCTCCCATCCAAGCTAGGTGTTTTAAGTAAATGGGCGGCTGAATCGGTCAGG
TACATCTTCCTTCCGGCCTCTACATTCATCGCAAACACAAAAGGGTATCCCGTCCTCCCAAAACCCACACAAGAT
TTCATTCGGGACTGTATGATTGTATGCGCATTACTTTTTCTCGGTTCTCACTCAACCAAGACGTCTGTGACACTT
CTTCCTTAGCATCGGCCAACTGTAATACTTGCGGATGTCATCACGAATAAACATTCACGCGGGGGTGAAGTTGCT
TATTCCCAGTATGTTAAGTTCTTGGAGAAGACGAGTGCAGTCGTACGGAACGCACATCAATCGGGAACTGTCGAA
CATTTTGCTCAGGGATATCAAGATTACTTACAGGCCCCATTGCAGGTGTGTTATACCTTTATCAAAATTGATAGC
AAAAGTTAAATCTAACTTTGCAATAGCCATTAATGGATAACCTGCAAAGTATGACTTATCAGACGTTTGAGCAGG
ATCCTGTCAAGTATGAGAGGTATGAGGAGGTGTGTACGTTGATTAGAGGGCATGGTGTAAATAATAACGACGGTA
TTGGTGACAGGCAATTTTCAGAGCACTCCAGGAGTGGCCACCTGGACAACGAGTGTAAGCACTTTGATGTAGTTA
TCTCCCCAAATAACTGAACGAGGTCGTAGAGTTTGTTGTATAGCGGGTGCAGGTCGCGGGCCACTTGTGACAAGA
TGTCTGAGTGCAATTGACCGTTGTAAAAGAGATGTCTCCGTTTATGCGGTAGAAAAAAACCCGAATGCCTATGTT
ACGTGAGTCCGGATTCATCTCGCGGTCTTTAAGCTGGTAATCTAGAATTTACCCCTCCTAGATTACAACAGAGGA
AAGTTCGAGAGTGGGGTGATAGGGTCAAATTGCTGTTTGGCGATATGAGGCTGCTAGAGGTACCCGAACCTGTTG
ACATTCTGATTAGCGAATTACTGGGATCTTTTGGGGACAATGAGCTCAGTCCGGAATGCTTGGATGGTGCACAGC
GCTTTTTAAAGCGTAAATCTAAATTACCCTCGTCCATCGGAGTAGAGGCTAATCATCCTTGACAGCGACGGGAAT
TTCGATCCCTTCCTCCTATACGGCGCATCTAGCTCCTCTTTCATCTTCAAAGTTGTACAATGAAGCAAGATCAGG
GAAAAACGCGCAGTCACTAGAAACTCCCTATGTAGTCATGTTCCAGGCTGTCAATATCCTTAGTGGAGACAAACA
GGAGCCAGGCGGGAGGTGTGGCCCTCAAATTCAAGAGTGCTGGGAATTCGAGCATCCAAGGAAGGATGTGATCCT
GAATACGCAGGGTGAATTTAGTTGTGAAACCAATTCATTTTCGTGCGAAATGGACTTACCGTGCTTACGACTAGG
AACTCCTTTGACCAACAATCATAATGTTCGGTCCGCTAGGCTGAGGTTCTGGATTCCCCATGCGGGTGTATTGCA
GTATGTTTCCGGATCTATGCGGGCTGTACGATATGTTTGATGCGTGGCATATAGCGGTCTGGCTGGTTATTTTGA
AGCAGTAGGCCTCTTCTCAATCAAGTTATGTCATGATATGCACATGGATTACAGATTCTGTATGGAAACGTTGGG
TTGAGCATTCATCCACATAGAAAGGATGTAGTATCGAAGGATATGTTGAGCTGGTTTCCCCTCTTCTTTCCGTTC
AAGGTACGCTTCTTAATCCCCATAAGGCTGACTGGTTGCCTTAATTCATTTCAGGAGCCGCTATATCTCCCGAGC
GGATCTGAGTTACAGGTATCTATTTGGCGGTTAACAAATGAACGACAGGTGTGGTATGAATGGCACGCAGAGTCG
TTTTTGATGATTATGACCACTCCTGGAGGAAAGGATGAACTATCGATGTATTCCGGTGGAAGGCAGAACTTGCCT
TCTCCGACGACCATTCCAAGTCCTCTTGCCGATGACGATGCTTTCTTCAGGACACCTGCTCAGTCACAAAAACAC
CTATCACAAAGGGCTGCATCGTTAGGAGGTGGTGGCGGGTATGAGGTTGTAAAGATTGGGCATACTAGTCTGCAT
AATCCTGGTGGCAGGAGCAGTTGGATCGGGCTATAGGTGTGTTCTCCTGACCAGTGCGGAGCGATGGGTCGTTGA
CCATGGTAATACTTTGAACACTGAGGGCGAGCATTCGGCCTTGGGATTTGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail