Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084350
Gene name
Locationscaffold_5:1536438..1537477
Strand-
Gene length (bp)1039
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 14.47 6.15 22.78
Initials Initials knots 27.67 13.66 41.68
Pileal_Stipeal_center Stage I stipe center 19.46 9.12 29.81
Pileal_Stipeal_shell Stage I stipe shell 121.62 71.07 172.18
DIF_stipe_center Stage II stipe center 17.15 7.87 26.43
DIF_stipe_shell Stage II stipe shell 20.35 9.51 31.18
DIF_stipe_skin Stage II stipe skin 37.05 16.89 57.20
DIF_cap_skin Stage II cap skin 31.20 15.66 46.74
DIF_cap_tissue Stage II cap tissue 90.74 49.83 131.65
DIF_gill_tissue Stage II gill tissue 151.15 84.82 217.48
YFB_stipe_center Young fruiting body stipe center 20.69 9.67 31.71
YFB_stipe_shell Young fruiting body stipe shell 25.68 12.46 38.91
YFB_stipe_skin Young fruiting body stipe skin 27.07 13.18 40.96
YFB_cap_skin Young fruiting body cap skin 21.86 10.44 33.27
YFB_cap_tissue Young fruiting body cap tissue 17.38 8.04 26.71
YFB_gill_tissue Young fruiting body gill tissue 36.89 17.57 56.20
YFB_veil Young fruiting body veil 127.62 70.08 185.16

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.426697 no
Casing YFB_stipe_shell 0.137864 no
Casing YFB_stipe_skin 0.101372 no
Casing YFB_cap_skin 0.340284 no
Casing YFB_cap_tissue 0.758062 no
Casing YFB_gill_tissue 0.006032 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.076984 no
Casing Pileal_Stipeal_center 0.536081 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.780028 no
Casing DIF_stipe_shell 0.453578 no
Casing DIF_stipe_skin 0.007092 yes
Casing DIF_cap_skin 0.031088 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.708992 no
YFB_stipe_center YFB_stipe_shell 0.669030 no
YFB_stipe_center YFB_stipe_skin 0.574403 no
YFB_stipe_center YFB_cap_skin 0.937154 no
YFB_stipe_center YFB_cap_tissue 0.758649 no
YFB_stipe_center YFB_gill_tissue 0.120057 no
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.939846 no
YFB_stipe_shell YFB_cap_skin 0.773596 no
YFB_stipe_shell YFB_cap_tissue 0.366932 no
YFB_stipe_shell YFB_gill_tissue 0.402033 no
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.683664 no
YFB_stipe_skin YFB_cap_tissue 0.290256 no
YFB_stipe_skin YFB_gill_tissue 0.507667 no
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.657272 no
YFB_cap_skin YFB_gill_tissue 0.173079 no
YFB_cap_skin YFB_veil 0.000613 yes
YFB_cap_tissue YFB_gill_tissue 0.040501 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.000613 yes
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.510817 no
Initials YFB_stipe_shell 0.908127 no
Initials YFB_stipe_skin 0.974729 no
Initials YFB_cap_skin 0.627777 no
Initials YFB_cap_tissue 0.241697 no
Initials YFB_gill_tissue 0.528339 no
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.397593 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.213894 no
Initials DIF_stipe_shell 0.476848 no
Initials DIF_stipe_skin 0.516246 no
Initials DIF_cap_skin 0.836814 no
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.926770 no
Pileal_Stipeal_center YFB_stipe_shell 0.551629 no
Pileal_Stipeal_center YFB_stipe_skin 0.458243 no
Pileal_Stipeal_center YFB_cap_skin 0.850027 no
Pileal_Stipeal_center YFB_cap_tissue 0.855230 no
Pileal_Stipeal_center YFB_gill_tissue 0.078769 no
Pileal_Stipeal_center YFB_veil 0.000613 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.838748 no
Pileal_Stipeal_center DIF_stipe_shell 0.949928 no
Pileal_Stipeal_center DIF_stipe_skin 0.074661 no
Pileal_Stipeal_center DIF_cap_skin 0.217972 no
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.578285 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_veil 0.934109 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.416744 no
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.736294 no
DIF_stipe_center YFB_stipe_shell 0.342737 no
DIF_stipe_center YFB_stipe_skin 0.271655 no
DIF_stipe_center YFB_cap_skin 0.638440 no
DIF_stipe_center YFB_cap_tissue 0.985153 no
DIF_stipe_center YFB_gill_tissue 0.032266 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.765855 no
DIF_stipe_center DIF_stipe_skin 0.032504 yes
DIF_stipe_center DIF_cap_skin 0.108546 no
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.980506 no
DIF_stipe_shell YFB_stipe_shell 0.634621 no
DIF_stipe_shell YFB_stipe_skin 0.540230 no
DIF_stipe_shell YFB_cap_skin 0.915232 no
DIF_stipe_shell YFB_cap_tissue 0.788263 no
DIF_stipe_shell YFB_gill_tissue 0.106812 no
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.105702 no
DIF_stipe_shell DIF_cap_skin 0.270661 no
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.116868 no
DIF_stipe_skin YFB_stipe_shell 0.399441 no
DIF_stipe_skin YFB_stipe_skin 0.500031 no
DIF_stipe_skin YFB_cap_skin 0.167625 no
DIF_stipe_skin YFB_cap_tissue 0.035537 yes
DIF_stipe_skin YFB_gill_tissue 0.995045 no
DIF_stipe_skin YFB_veil 0.000613 yes
DIF_stipe_skin DIF_cap_skin 0.756657 no
DIF_stipe_skin DIF_cap_tissue 0.006387 yes
DIF_cap_skin DIF_gill_tissue 0.000613 yes
DIF_cap_skin YFB_stipe_center 0.300784 no
DIF_cap_skin YFB_stipe_shell 0.705867 no
DIF_cap_skin YFB_stipe_skin 0.806592 no
DIF_cap_skin YFB_cap_skin 0.400308 no
DIF_cap_skin YFB_cap_tissue 0.115496 no
DIF_cap_skin YFB_gill_tissue 0.762607 no
DIF_cap_skin YFB_veil 0.000613 yes
DIF_cap_skin DIF_cap_tissue 0.001140 yes
DIF_cap_tissue DIF_gill_tissue 0.102993 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.000613 yes
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.002951 yes
DIF_cap_tissue YFB_veil 0.341228 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084350
MQLTIATAAALALVYARSAFAVMGIDTPSTLVQCQPSLLAWHEGAPPYYLSVIPGGQPGATPLKSFDAVNDLSRT
WVVDIASGTVVTIVLKDSSGAIAYSDKVPIQGSQDNSCIIPAAAPAPAPASATAAAPAPPANGASVSPASPAPAS
QPPAAPAVSPPAGQAPPPPASRPTGSQAAVASSSAKPSSGANRASVVNGFAGLLAILGVALF*
Coding >AgabiH97|084350
ATGCAGCTCACTATTGCTACTGCCGCCGCCCTCGCCCTTGTCTATGCGCGATCCGCTTTCGCCGTCATGGGTATC
GATACCCCTTCGACCCTTGTGCAATGCCAACCGTCCCTTTTGGCGTGGCACGAGGGTGCGCCTCCCTATTACCTC
TCTGTCATCCCGGGTGGTCAGCCCGGTGCAACTCCGCTTAAATCTTTTGATGCGGTGAATGATTTATCCCGCACT
TGGGTCGTCGATATTGCGAGCGGAACAGTAGTTACCATCGTGCTCAAGGATTCTTCAGGTGCTATCGCATACAGC
GACAAAGTACCCATTCAAGGGAGCCAAGATAACTCGTGTATAATTCCCGCTGCGGCACCAGCACCAGCACCAGCG
TCGGCGACCGCTGCCGCTCCTGCACCCCCAGCCAACGGGGCTAGCGTATCTCCTGCGTCTCCTGCTCCTGCTAGC
CAACCTCCTGCTGCTCCAGCAGTAAGCCCCCCCGCTGGACAGGCTCCTCCCCCACCCGCCTCCAGGCCCACTGGT
TCTCAGGCAGCCGTTGCTTCTTCTAGTGCTAAGCCTTCAAGCGGTGCCAATCGCGCCTCGGTTGTCAACGGATTC
GCTGGGCTTCTAGCGATTCTTGGTGTCGCACTTTTCTAA
Transcript >AgabiH97|084350
ATGCAGCTCACTATTGCTACTGCCGCCGCCCTCGCCCTTGTCTATGCGCGATCCGCTTTCGCCGTCATGGGTATC
GATACCCCTTCGACCCTTGTGCAATGCCAACCGTCCCTTTTGGCGTGGCACGAGGGTGCGCCTCCCTATTACCTC
TCTGTCATCCCGGGTGGTCAGCCCGGTGCAACTCCGCTTAAATCTTTTGATGCGGTGAATGATTTATCCCGCACT
TGGGTCGTCGATATTGCGAGCGGAACAGTAGTTACCATCGTGCTCAAGGATTCTTCAGGTGCTATCGCATACAGC
GACAAAGTACCCATTCAAGGGAGCCAAGATAACTCGTGTATAATTCCCGCTGCGGCACCAGCACCAGCACCAGCG
TCGGCGACCGCTGCCGCTCCTGCACCCCCAGCCAACGGGGCTAGCGTATCTCCTGCGTCTCCTGCTCCTGCTAGC
CAACCTCCTGCTGCTCCAGCAGTAAGCCCCCCCGCTGGACAGGCTCCTCCCCCACCCGCCTCCAGGCCCACTGGT
TCTCAGGCAGCCGTTGCTTCTTCTAGTGCTAAGCCTTCAAGCGGTGCCAATCGCGCCTCGGTTGTCAACGGATTC
GCTGGGCTTCTAGCGATTCTTGGTGTCGCACTTTTCTAA
Gene >AgabiH97|084350
ATGCAGCTCACTATTGCTACTGCCGCCGCCCTCGCCCTTGTCTATGCGCGATCCGCTTTCGCCGTCATGGGTATC
GATACCCCGTACGTTGCCCGTACTCTTCACATCACGCGTATACTCACCTCCATTCCAGTTCGACCCTTGTGCAAT
GCCGTGTGTAGATGATAATTCATTTTTTCAACGTTTCAACTGAGCACCATGCCATCGTTATATAGAACCGTCCCT
TTTGGCGTGGCACGAGGGTGCGCCTCCCTATTACCTCTCTGTCATCCCGGGTGCGTTGTGTCGTTGATATGCTTG
GTTGAACGAATTGAATTCTGAGACAATGTATTTAGGTGGTCAGCCCGGTGCAACTCCGGTGAGTTTTCGAGGGCT
CGACATGCTATTTTGAGTATTTGATCTGACTTTTTTGGTGCATAGCTTAAATCTTTTGATGCGGTGAATGATTTA
TCCCGCACTTGGGTCGTCGATATTGCGAGCGGAACAGTAGTGTGCGTGATCGCTTATGTGATGTGTCGATATATG
CTTATCGTGTTTGGTTAGTACCATCGTGCTCAAGGATTCTTCAGGTGCTATCGCATACAGCGACAAAGTACCCAT
TCAAGGGAGCCAAGATAACTCGTATACTGCTTTCTATATGGGGTTAATGTCTTTGATCTAATTAATTTTATCTCG
TGTAGGTGTATAATTCCCGCTGCGGCACCAGCACCAGCACCAGCGTCGGCGACCGCTGCCGCTCCTGCACCCCCA
GCCAACGGGGCTAGCGTATCTCCTGCGTCTCCTGCTCCTGCTAGCCAACCTCCTGCTGCTCCAGCAGTAAGCCCC
CCCGCTGGACAGGCTCCGTGAGTGGCATTATTTGTGCTATCAGTGACGGACATATATTTATACTTGCATAAGTCC
CCCACCCGCCTCCAGGCCCACTGGTTCTCAGGCAGCCGTTGCTTCTTCTAGTGCTAAGCCTTCAAGCGGTGCCAA
TCGCGCCTCGGTTGTCAACGGATTCGCTGGGCTTCTAGCGATTCTTGGTGTCGCACTTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail