Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084330
Gene name
Locationscaffold_5:1527903..1529542
Strand-
Gene length (bp)1639
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12928 tRNA_int_end_N2 tRNA-splicing endonuclease subunit sen54 N-term 2.0E-20 79 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74908|SEN54_SCHPO Probable tRNA-splicing endonuclease subunit sen54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen54 PE=3 SV=1 48 453 3.0E-37
sp|Q74ZJ5|SEN54_ASHGO tRNA-splicing endonuclease subunit SEN54 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEN54 PE=3 SV=1 26 452 5.0E-27
sp|Q7SC91|SEN54_NEUCR Probable tRNA-splicing endonuclease subunit tsp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tsp-5 PE=3 SV=2 50 453 2.0E-21
sp|Q02825|SEN54_YEAST tRNA-splicing endonuclease subunit SEN54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN54 PE=1 SV=1 35 452 2.0E-18
sp|Q8C2A2|SEN54_MOUSE tRNA-splicing endonuclease subunit Sen54 OS=Mus musculus GN=Tsen54 PE=2 SV=2 48 214 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74908|SEN54_SCHPO Probable tRNA-splicing endonuclease subunit sen54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen54 PE=3 SV=1 48 453 3.0E-37
sp|Q74ZJ5|SEN54_ASHGO tRNA-splicing endonuclease subunit SEN54 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEN54 PE=3 SV=1 26 452 5.0E-27
sp|Q7SC91|SEN54_NEUCR Probable tRNA-splicing endonuclease subunit tsp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tsp-5 PE=3 SV=2 50 453 2.0E-21
sp|Q02825|SEN54_YEAST tRNA-splicing endonuclease subunit SEN54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN54 PE=1 SV=1 35 452 2.0E-18
sp|Q8C2A2|SEN54_MOUSE tRNA-splicing endonuclease subunit Sen54 OS=Mus musculus GN=Tsen54 PE=2 SV=2 48 214 4.0E-11
sp|Q7Z6J9|SEN54_HUMAN tRNA-splicing endonuclease subunit Sen54 OS=Homo sapiens GN=TSEN54 PE=1 SV=3 48 214 8.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084330
MDDSLEQPSLIAAKADEVPLEDDDQSSGDEDGALDWTKLIPTVARPVMPKRGEKEFEPRANGGTNLQLHILDRAR
SAMFEALRSVRTISSKGISYGIWYPGLGRTHVTVARGIHFSTMGHSAPRPFVDENGASKTHKRLELLPEEAIYLI
ERGALFCWKECNMDLSSLQGFEGFAGVPMSVQQAYAEMIGRENLTLDKFQVYAYLRRLGYVVTRAEAPNDSYPMP
PPFDLSKPKPKASLLCRIFLPISYILSRARRVFARSFSWWKPLCLSRWLHHDNASIYRSLRFMSAGHDNTLNRPV
PTTLVASYSPYRIFFNVYKPSTPFKKTAPPLPDFQVVVVNARTTPMPTLHELSALFDLLPELPPPLPRPRRQAYG
TKSAAPAPAITASSPGSPSTFLQRVFPFFFSPPKQSQEFRRRPNPFAALKQGKKIIVIAAVDNGNISFFRFSQGA
FAEWPMA*
Coding >AgabiH97|084330
ATGGATGACTCCCTCGAACAACCCAGTTTGATCGCTGCCAAGGCCGACGAGGTACCGTTGGAGGACGATGACCAG
TCGTCGGGTGACGAAGATGGCGCTCTGGACTGGACCAAGCTAATTCCCACTGTAGCTCGCCCTGTTATGCCCAAG
CGGGGAGAAAAAGAGTTTGAACCCAGAGCAAATGGAGGCACCAACCTTCAACTCCATATCTTGGATCGAGCACGG
TCAGCCATGTTCGAAGCGTTGCGTTCAGTCCGGACGATTTCAAGTAAGGGCATTAGCTACGGTATCTGGTATCCA
GGACTTGGCAGAACTCATGTCACCGTGGCTCGTGGCATACACTTCTCTACTATGGGCCACTCTGCTCCTCGGCCA
TTCGTTGACGAAAATGGGGCAAGCAAAACTCATAAAAGACTGGAACTGCTCCCTGAAGAGGCTATTTATTTGATA
GAGAGAGGTGCCCTCTTTTGTTGGAAAGAATGCAATATGGATCTTTCCTCGCTACAGGGCTTCGAGGGTTTTGCC
GGCGTTCCAATGAGTGTTCAGCAAGCGTACGCAGAGATGATAGGAAGGGAAAATCTAACATTAGACAAATTTCAG
GTCTATGCGTACCTTCGTAGGCTTGGATATGTTGTAACTCGAGCTGAAGCACCAAATGACTCGTACCCAATGCCC
CCTCCTTTTGACCTCTCCAAACCCAAACCGAAGGCTTCATTACTTTGCCGAATATTTTTACCCATATCTTATATC
CTTTCAAGAGCACGTCGTGTTTTTGCTCGCAGCTTCAGCTGGTGGAAACCTCTCTGCTTAAGTAGATGGTTACAT
CACGATAATGCTTCAATATATCGCTCACTCCGCTTCATGTCCGCCGGCCACGACAACACCTTGAACAGACCAGTC
CCTACCACATTAGTAGCGTCGTATTCACCCTACAGAATATTTTTCAATGTCTACAAACCATCGACACCATTCAAG
AAAACGGCACCTCCCTTGCCTGATTTTCAAGTCGTGGTCGTAAATGCTCGAACGACACCTATGCCAACCCTACAC
GAGCTCTCTGCACTATTTGATCTCCTTCCCGAACTCCCACCACCCCTACCGCGGCCGAGGCGACAAGCTTACGGT
ACAAAATCTGCAGCGCCCGCTCCTGCAATTACTGCATCCTCGCCTGGGTCCCCATCAACTTTTCTCCAGAGAGTC
TTTCCCTTTTTCTTTTCCCCCCCAAAACAATCGCAAGAGTTCCGACGCAGACCAAATCCATTTGCAGCACTTAAA
CAAGGCAAAAAGATCATCGTCATCGCCGCAGTAGATAATGGTAATATCAGTTTCTTCCGGTTCAGTCAGGGTGCA
TTTGCAGAGTGGCCTATGGCTTAG
Transcript >AgabiH97|084330
ATGGATGACTCCCTCGAACAACCCAGTTTGATCGCTGCCAAGGCCGACGAGGTACCGTTGGAGGACGATGACCAG
TCGTCGGGTGACGAAGATGGCGCTCTGGACTGGACCAAGCTAATTCCCACTGTAGCTCGCCCTGTTATGCCCAAG
CGGGGAGAAAAAGAGTTTGAACCCAGAGCAAATGGAGGCACCAACCTTCAACTCCATATCTTGGATCGAGCACGG
TCAGCCATGTTCGAAGCGTTGCGTTCAGTCCGGACGATTTCAAGTAAGGGCATTAGCTACGGTATCTGGTATCCA
GGACTTGGCAGAACTCATGTCACCGTGGCTCGTGGCATACACTTCTCTACTATGGGCCACTCTGCTCCTCGGCCA
TTCGTTGACGAAAATGGGGCAAGCAAAACTCATAAAAGACTGGAACTGCTCCCTGAAGAGGCTATTTATTTGATA
GAGAGAGGTGCCCTCTTTTGTTGGAAAGAATGCAATATGGATCTTTCCTCGCTACAGGGCTTCGAGGGTTTTGCC
GGCGTTCCAATGAGTGTTCAGCAAGCGTACGCAGAGATGATAGGAAGGGAAAATCTAACATTAGACAAATTTCAG
GTCTATGCGTACCTTCGTAGGCTTGGATATGTTGTAACTCGAGCTGAAGCACCAAATGACTCGTACCCAATGCCC
CCTCCTTTTGACCTCTCCAAACCCAAACCGAAGGCTTCATTACTTTGCCGAATATTTTTACCCATATCTTATATC
CTTTCAAGAGCACGTCGTGTTTTTGCTCGCAGCTTCAGCTGGTGGAAACCTCTCTGCTTAAGTAGATGGTTACAT
CACGATAATGCTTCAATATATCGCTCACTCCGCTTCATGTCCGCCGGCCACGACAACACCTTGAACAGACCAGTC
CCTACCACATTAGTAGCGTCGTATTCACCCTACAGAATATTTTTCAATGTCTACAAACCATCGACACCATTCAAG
AAAACGGCACCTCCCTTGCCTGATTTTCAAGTCGTGGTCGTAAATGCTCGAACGACACCTATGCCAACCCTACAC
GAGCTCTCTGCACTATTTGATCTCCTTCCCGAACTCCCACCACCCCTACCGCGGCCGAGGCGACAAGCTTACGGT
ACAAAATCTGCAGCGCCCGCTCCTGCAATTACTGCATCCTCGCCTGGGTCCCCATCAACTTTTCTCCAGAGAGTC
TTTCCCTTTTTCTTTTCCCCCCCAAAACAATCGCAAGAGTTCCGACGCAGACCAAATCCATTTGCAGCACTTAAA
CAAGGCAAAAAGATCATCGTCATCGCCGCAGTAGATAATGGTAATATCAGTTTCTTCCGGTTCAGTCAGGGTGCA
TTTGCAGAGTGGCCTATGGCTTAG
Gene >AgabiH97|084330
ATGGATGACTCCCTCGAACAACCCAGTTTGATCGCTGCCAAGGCCGACGAGGTACCGTTGGAGGACGATGACCAG
TCGTCGGGTGACGAAGATGGCGCTCTGGACTGGACCAAGCTAATGTAACCGCGACATCTACAGTCTCCTTCCTCA
GTTGTCATTGAATCATCAATGTTAGTCCCACTGTAGCTCGCCCTGTTATGCCCAAGCGGGGAGAAAAAGAGTTTG
AACCCAGAGCAAATGGAGGCACCAACCTTCAACTCCATATCTTGGATCGAGCACGGTCAGCCATGTTCGAAGCGT
TGCGTTCAGTCCGGACGATTTCAAGGCAAAGTTTTCATCTTTTTCGCATCATTCTGACATTCTGACATTCGCTTC
TAGTAAGGGCATTAGCTACGGTATCTGGTATCCAGGACTTGGCAGAACTCATGTCACCGTGGCTCGTGGCATACA
CTTCTCTACTATGGGCCACTCTGCTCCTCGGCCATTCGTTGACGAAAATGGGGCAAGCAAAACTCATAAAAGACT
GGAACTGCTCCCTGAAGAGGCTATTTATTTGATAGAGAGAGGTGCCCTCTTTTGTTGGAAAGAATGCAATATGGA
TCTTTCCTCGCTACAGGGCTTCGAGGGTTTTGCCGGCGTTCCAATGAGTGTTCAGCAAGCGTACGCAGAGATGAT
AGGAAGGGAAAATCTAACATTAGACAAATTTCAGGTCCGATTGACTTATGCTTCTTTTGTTATTCACTCACGCCT
TGGATAGGTCTATGCGTACCTTCGTAGGCTTGGATATGTTGTAACTCGAGCTGAAGCACCAAATGACTCGTACCC
AATGCCCCCTCCTTTTGACCTCTCCAAACCCAAACCGAAGGCTTCATTACTTTGCCGAATATTTTTACCCATATC
TTATATCCTTTCAAGAGCACGTCGTGTTTTTGCTCGCAGCTTCAGCTGGTGGAAACCTCTCTGCTTAAGTAGATG
GTTACATCACGATAATGGTGTGTTCAATTTCGTTCTCAATTTGAAATCATCTTATAATTCATTTCAGCTTCAATA
TATCGCTCACTCCGCTTCATGTCCGCCGGCCACGACAACACCTTGAACAGACCAGTCCCTACCACATTAGTAGCG
TCGTATTCACCCTACAGAATATTTTTCAATGTCTACAAACCATCGACACCATTCAAGAAAACGGCACCTCCCTTG
CCTGATTTTCAAGTCGTGGTCGTAAAGTAAGACTTGAGCTCACCTGTTTTTATTGTGATCTCAGGTATAATGTGA
CTCATCTAGTGCTCGAACGACACCTATGCCAACCCTACACGAGCTCTCTGCACTATTTGATCTCCTTCCCGAACT
CCCACCACCCCTACCGCGGCCGAGGCGACAAGCTTACGGTACAAAATCTGCAGCGCCCGCTCCTGCAATTACTGC
ATCCTCGCCTGGGTCCCCATCAACTTTTCTCCAGAGAGTCTTTCCCTTTTTCTTTTCCCCCCCAAAACAATCGCA
AGAGTTCCGACGCAGACCAAATCCATTTGCAGCACTTAAACAAGGCAAAAAGATCATCGTCATCGCCGCAGTAGA
TAATGGTAATATCAGTTTCTTCCGGTTCAGTCAGGGTGCATTTGCAGAGTGGCCTATGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail