Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|084050
Gene name
Locationscaffold_5:1460146..1462468
Strand+
Gene length (bp)2322
Transcript length (bp)1560
Coding sequence length (bp)1560
Protein length (aa) 520

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain 3.0E-29 352 507
PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain 6.1E-20 250 340
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 3.2E-16 10 69
PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain 3.6E-13 120 246
PF08028 Acyl-CoA_dh_2 Acyl-CoA dehydrogenase, C-terminal domain 5.0E-05 378 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q75IM9|IVD_ORYSJ Isovaleryl-CoA dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=Os05g0125500 PE=2 SV=2 116 471 1.0E-36
sp|O32176|FADE_BACSU Probable acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=fadE PE=2 SV=1 114 500 9.0E-34
sp|P50544|ACADV_MOUSE Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadvl PE=1 SV=3 131 501 2.0E-33
sp|Q9VSA3|ACADM_DROME Probable medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG12262 PE=1 SV=1 104 473 3.0E-33
sp|Q9FS88|MBCD_SOLTU 2-methylacyl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum GN=2MBCD PE=1 SV=2 116 471 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q75IM9|IVD_ORYSJ Isovaleryl-CoA dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=Os05g0125500 PE=2 SV=2 116 471 1.0E-36
sp|O32176|FADE_BACSU Probable acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=fadE PE=2 SV=1 114 500 9.0E-34
sp|P50544|ACADV_MOUSE Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadvl PE=1 SV=3 131 501 2.0E-33
sp|Q9VSA3|ACADM_DROME Probable medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG12262 PE=1 SV=1 104 473 3.0E-33
sp|Q9FS88|MBCD_SOLTU 2-methylacyl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum GN=2MBCD PE=1 SV=2 116 471 4.0E-33
sp|P45953|ACADV_RAT Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadvl PE=1 SV=1 87 501 5.0E-33
sp|Q8HXY7|ACADV_MACFA Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=ACADVL PE=2 SV=1 132 501 6.0E-33
sp|P49748|ACADV_HUMAN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADVL PE=1 SV=1 132 501 5.0E-32
sp|Q9SWG0|IVD_ARATH Isovaleryl-CoA dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=IVD PE=1 SV=2 121 471 2.0E-31
sp|Q9H845|ACAD9_HUMAN Acyl-CoA dehydrogenase family member 9, mitochondrial OS=Homo sapiens GN=ACAD9 PE=1 SV=1 215 474 7.0E-31
sp|Q9FS87|IVD_SOLTU Isovaleryl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum GN=IVD PE=1 SV=2 116 471 8.0E-31
sp|A8XNF0|ACAD1_CAEBR Probable medium-chain specific acyl-CoA dehydrogenase 1, mitochondrial OS=Caenorhabditis briggsae GN=CBG15946 PE=3 SV=1 119 472 3.0E-30
sp|Q5RBD5|IVD_PONAB Isovaleryl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=IVD PE=2 SV=1 119 471 1.0E-29
sp|P45857|ACDB_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgC PE=2 SV=3 221 474 3.0E-29
sp|Q22347|ACADM_CAEEL Probable medium-chain specific acyl-CoA dehydrogenase 10, mitochondrial OS=Caenorhabditis elegans GN=acdh-10 PE=2 SV=1 119 472 3.0E-29
sp|P45867|ACDA_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=acdA PE=2 SV=1 119 500 4.0E-29
sp|P26440|IVD_HUMAN Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=IVD PE=1 SV=1 184 471 5.0E-29
sp|C3UVB0|ACD_DESML Glutaryl-CoA dehydrogenase OS=Desulfococcus multivorans GN=Acd PE=1 SV=1 184 416 8.0E-29
sp|Q60HI0|ACADL_MACFA Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=ACADL PE=2 SV=1 119 510 8.0E-29
sp|P79274|ACADL_PIG Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa GN=ACADL PE=2 SV=1 119 512 9.0E-29
sp|P48818|ACADV_BOVIN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADVL PE=2 SV=3 221 501 1.0E-28
sp|Q8JZN5|ACAD9_MOUSE Acyl-CoA dehydrogenase family member 9, mitochondrial OS=Mus musculus GN=Acad9 PE=1 SV=2 215 471 2.0E-28
sp|Q3SZB4|ACADM_BOVIN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADM PE=2 SV=1 112 473 3.0E-28
sp|P28330|ACADL_HUMAN Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADL PE=1 SV=2 119 510 3.0E-28
sp|Q2LQP0|CHCOA_SYNAS Cyclohexane-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) GN=SYN_02586 PE=1 SV=1 221 500 6.0E-28
sp|P08503|ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadm PE=1 SV=1 112 473 1.0E-27
sp|P9WQG1|ACDP_MYCTU Probable acyl-CoA dehydrogenase fadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadE25 PE=1 SV=1 121 473 2.0E-27
sp|P9WQG0|ACDP_MYCTO Probable acyl-CoA dehydrogenase fadE25 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadE25 PE=3 SV=1 121 473 2.0E-27
sp|P63428|ACDP_MYCBO Probable acyl-CoA dehydrogenase fadE25 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadE25 PE=3 SV=1 121 473 2.0E-27
sp|Q9JHI5|IVD_MOUSE Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Ivd PE=1 SV=1 174 471 2.0E-27
sp|P11310|ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADM PE=1 SV=1 112 473 4.0E-27
sp|A5A6I0|ACADM_PANTR Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pan troglodytes GN=ACADM PE=2 SV=1 112 473 4.0E-27
sp|Q3SZI8|IVD_BOVIN Isovaleryl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=IVD PE=2 SV=1 119 471 1.0E-26
sp|P12007|IVD_RAT Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Ivd PE=1 SV=2 174 500 1.0E-26
sp|P41367|ACADM_PIG Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa GN=ACADM PE=1 SV=3 102 473 5.0E-26
sp|P45952|ACADM_MOUSE Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadm PE=1 SV=1 112 473 5.0E-26
sp|P51174|ACADL_MOUSE Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadl PE=1 SV=2 119 512 7.0E-26
sp|P15651|ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acads PE=1 SV=2 91 500 8.0E-26
sp|Q8HXY8|ACADM_MACFA Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=ACADM PE=2 SV=1 112 473 1.0E-25
sp|Q07417|ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acads PE=1 SV=2 121 500 1.0E-25
sp|P46703|ACDP_MYCLE Probable acyl-CoA dehydrogenase fadE25 OS=Mycobacterium leprae (strain TN) GN=fadE25 PE=3 SV=1 172 500 1.0E-25
sp|P0A9U8|YDIO_ECOLI Probable acyl-CoA dehydrogenase YdiO OS=Escherichia coli (strain K12) GN=ydiO PE=3 SV=1 177 512 2.0E-25
sp|P0A9U9|YDIO_ECOL6 Probable acyl-CoA dehydrogenase YdiO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydiO PE=3 SV=1 177 512 2.0E-25
sp|P0A9V0|YDIO_ECO57 Probable acyl-CoA dehydrogenase YdiO OS=Escherichia coli O157:H7 GN=ydiO PE=3 SV=1 177 512 2.0E-25
sp|Q06319|ACDS_MEGEL Acyl-CoA dehydrogenase, short-chain specific OS=Megasphaera elsdenii PE=1 SV=1 225 474 6.0E-25
sp|Q0NXR6|ACAD8_BOVIN Isobutyryl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACAD8 PE=2 SV=1 229 501 1.0E-24
sp|P34275|IVD_CAEEL Probable acyl-CoA dehydrogenase 6 OS=Caenorhabditis elegans GN=acdh-6 PE=3 SV=2 119 501 1.0E-24
sp|P15650|ACADL_RAT Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadl PE=1 SV=1 119 512 3.0E-24
sp|Q5RAS0|ACADS_PONAB Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=ACADS PE=2 SV=1 174 500 7.0E-24
sp|Q54IM8|ACAD8_DICDI Isobutyryl-CoA dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=acad8 PE=3 SV=1 229 501 8.0E-24
sp|Q9D7B6|ACAD8_MOUSE Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acad8 PE=1 SV=2 228 512 2.0E-23
sp|P16219|ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADS PE=1 SV=1 174 500 4.0E-23
sp|Q9UKU7|ACAD8_HUMAN Isobutyryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACAD8 PE=1 SV=1 228 501 4.0E-23
sp|A8WP91|ACAD2_CAEBR Probable medium-chain specific acyl-CoA dehydrogenase 2, mitochondrial OS=Caenorhabditis briggsae GN=CBG00953 PE=3 SV=2 119 428 7.0E-23
sp|Q2LQN9|CH1CO_SYNAS Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) GN=SYN_02587 PE=1 SV=1 222 500 3.0E-22
sp|Q8HXX8|GCDH_MACFA Glutaryl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=GCDH PE=2 SV=1 198 473 6.0E-22
sp|Q0T8F5|CAIA_SHIF8 Crotonobetainyl-CoA dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiA PE=3 SV=1 172 500 8.0E-22
sp|B7M0D6|CAIA_ECO8A Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|Q3Z5W9|CAIA_SHISS Crotonobetainyl-CoA dehydrogenase OS=Shigella sonnei (strain Ss046) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|P60587|CAIA_SHIFL Crotonobetainyl-CoA dehydrogenase OS=Shigella flexneri GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|Q32K58|CAIA_SHIDS Crotonobetainyl-CoA dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B7LWN0|CAIA_ESCF3 Crotonobetainyl-CoA dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|Q1RGF9|CAIA_ECOUT Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B1LFX2|CAIA_ECOSM Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B6HYZ0|CAIA_ECOSE Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain SE11) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B7N7R4|CAIA_ECOLU Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|P60584|CAIA_ECOLI Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain K12) GN=caiA PE=1 SV=1 172 500 1.0E-21
sp|B1IRD7|CAIA_ECOLC Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|P60585|CAIA_ECOL6 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|A1A789|CAIA_ECOK1 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|A7ZVY9|CAIA_ECOHS Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B1XBG4|CAIA_ECODH Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|C4ZPW5|CAIA_ECOBW Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B7MNP6|CAIA_ECO81 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B7NHE3|CAIA_ECO7I Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B5YYD3|CAIA_ECO5E Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|P60586|CAIA_ECO57 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O157:H7 GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B7L4G2|CAIA_ECO55 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B7MAG2|CAIA_ECO45 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|B7UI85|CAIA_ECO27 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|A7ZHD0|CAIA_ECO24 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|Q92947|GCDH_HUMAN Glutaryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=GCDH PE=1 SV=1 198 473 1.0E-21
sp|Q8GB20|CAIA_PROSL Crotonobetainyl-CoA dehydrogenase OS=Proteus sp. (strain LE138) GN=caiA PE=3 SV=1 199 500 1.0E-21
sp|B4EY23|CAIA_PROMH Crotonobetainyl-CoA dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=caiA PE=3 SV=1 199 500 1.0E-21
sp|Q8Z9L2|CAIA_SALTI Crotonobetainyl-CoA dehydrogenase OS=Salmonella typhi GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|Q0TLV0|CAIA_ECOL5 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiA PE=3 SV=1 172 500 1.0E-21
sp|Q8ZRX2|CAIA_SALTY Crotonobetainyl-CoA dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|B4TWR6|CAIA_SALSV Crotonobetainyl-CoA dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|B5BL57|CAIA_SALPK Crotonobetainyl-CoA dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|C0Q4L5|CAIA_SALPC Crotonobetainyl-CoA dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|A9MYJ9|CAIA_SALPB Crotonobetainyl-CoA dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|Q5PIN6|CAIA_SALPA Crotonobetainyl-CoA dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|B4T6J8|CAIA_SALNS Crotonobetainyl-CoA dehydrogenase OS=Salmonella newport (strain SL254) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|B4TIH2|CAIA_SALHS Crotonobetainyl-CoA dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|B5RGA6|CAIA_SALG2 Crotonobetainyl-CoA dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|B5R1R2|CAIA_SALEP Crotonobetainyl-CoA dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|B5FHG7|CAIA_SALDC Crotonobetainyl-CoA dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|Q57TI8|CAIA_SALCH Crotonobetainyl-CoA dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|B5F752|CAIA_SALA4 Crotonobetainyl-CoA dehydrogenase OS=Salmonella agona (strain SL483) GN=caiA PE=3 SV=1 172 500 2.0E-21
sp|O34421|ACDC_BACSU Probable acyl-CoA dehydrogenase YngJ OS=Bacillus subtilis (strain 168) GN=yngJ PE=3 SV=1 119 474 2.0E-21
sp|Q2KHZ9|GCDH_BOVIN Glutaryl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=GCDH PE=2 SV=1 198 473 2.0E-21
sp|Q20772|GCDH_CAEEL Probable glutaryl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=F54D5.7 PE=1 SV=1 198 485 2.0E-21
sp|A8ALR4|CAIA_CITK8 Crotonobetainyl-CoA dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiA PE=3 SV=1 172 500 5.0E-21
sp|G3KIM8|ACRC_CLOPR Acryloyl-CoA reductase (NADH) OS=Clostridium propionicum GN=acrC PE=1 SV=1 172 500 6.0E-21
sp|A9MQH5|CAIA_SALAR Crotonobetainyl-CoA dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiA PE=3 SV=1 172 500 6.0E-21
sp|P79273|ACADS_PIG Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa GN=ACADS PE=2 SV=1 121 500 3.0E-20
sp|Q5EAD4|ACDSB_BOVIN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADSB PE=2 SV=1 119 500 3.0E-20
sp|P70584|ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadsb PE=1 SV=1 114 500 4.0E-20
sp|P52042|ACDS_CLOAB Acyl-CoA dehydrogenase, short-chain specific OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bcd PE=1 SV=1 230 474 9.0E-20
sp|P81140|GCDH_PIG Glutaryl-CoA dehydrogenase, mitochondrial (Fragment) OS=Sus scrofa GN=GCDH PE=1 SV=1 198 473 1.0E-19
sp|Q60759|GCDH_MOUSE Glutaryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Gcdh PE=1 SV=2 198 473 2.0E-19
sp|P45954|ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADSB PE=1 SV=1 119 500 1.0E-18
sp|Q5RF40|ACDSB_PONAB Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=ACADSB PE=2 SV=1 119 500 2.0E-18
sp|Q3ZBF6|ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADS PE=1 SV=1 121 500 2.0E-18
sp|P63430|Y897_MYCBO Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadE10 PE=3 SV=1 215 510 4.0E-18
sp|P9WQF7|Y873_MYCTU Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadE10 PE=1 SV=1 215 510 4.0E-18
sp|P9WQF6|Y873_MYCTO Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadE10 PE=3 SV=1 215 510 4.0E-18
sp|Q54R47|GCDH_DICDI Glutaryl-CoA dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=gcdh PE=3 SV=1 210 472 6.0E-18
sp|Q9DBL1|ACDSB_MOUSE Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadsb PE=1 SV=1 230 500 8.0E-18
sp|Q96329|ACOX4_ARATH Acyl-coenzyme A oxidase 4, peroxisomal OS=Arabidopsis thaliana GN=ACX4 PE=1 SV=1 198 512 5.0E-15
sp|Q54RR5|ACDSB_DICDI Probable short/branched chain specific acyl-CoA dehydrogenase OS=Dictyostelium discoideum GN=acadsb PE=3 SV=1 229 515 7.0E-14
sp|Q9KJE8|BBSG_THAAR (R)-benzylsuccinyl-CoA dehydrogenase OS=Thauera aromatica GN=bbsG PE=1 SV=1 183 500 2.0E-13
sp|P9WQG3|ACDC_MYCTU Acyl-CoA dehydrogenase fadE12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadE12 PE=1 SV=1 184 474 1.0E-12
sp|P9WQG2|ACDC_MYCTO Acyl-CoA dehydrogenase fadE12 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadE12 PE=3 SV=1 184 474 1.0E-12
sp|Q7U0Y2|ACDC_MYCBO Acyl-CoA dehydrogenase fadE12 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadE12 PE=3 SV=1 184 474 1.0E-12
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 1 111 2.0E-12
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 5 90 3.0E-12
sp|Q73ZP8|MBTN_MYCPA Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtN PE=3 SV=1 202 504 4.0E-12
sp|Q1BBA3|MBTN_MYCSS Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium sp. (strain MCS) GN=mbtN PE=3 SV=1 189 504 8.0E-12
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 12 71 1.0E-11
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 10 101 5.0E-11
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 9 62 5.0E-11
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 4 89 8.0E-11
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 7 100 4.0E-10
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 10 62 4.0E-10
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 12 62 6.0E-10
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 7 62 6.0E-10
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 7 66 8.0E-10
sp|Q0VAX3|FS2P1_MOUSE Fatty acid desaturase 2-like protein FADS2P1 OS=Mus musculus GN=Fads2p1 PE=2 SV=1 4 90 1.0E-09
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 7 66 1.0E-09
sp|Q920R3|FADS1_RAT Fatty acid desaturase 1 OS=Rattus norvegicus GN=Fads1 PE=2 SV=1 4 91 1.0E-09
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 9 62 1.0E-09
sp|O60427|FADS1_HUMAN Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=3 7 100 2.0E-09
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 1 111 2.0E-09
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 7 85 3.0E-09
sp|Q920L1|FADS1_MOUSE Fatty acid desaturase 1 OS=Mus musculus GN=Fads1 PE=1 SV=1 4 91 3.0E-09
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 7 62 5.0E-09
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 7 105 6.0E-09
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 7 82 7.0E-09
sp|A4IFP3|FADS3_BOVIN Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=2 SV=1 6 90 7.0E-09
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 8 102 7.0E-09
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 7 101 1.0E-08
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 3 62 1.0E-08
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 10 90 2.0E-08
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 1 62 2.0E-08
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 5 108 2.0E-08
sp|P9WQF9|MBTN_MYCTU Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtN PE=1 SV=1 202 504 3.0E-08
sp|P9WQF8|MBTN_MYCTO Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtN PE=3 SV=1 202 504 3.0E-08
sp|P63432|MBTN_MYCBO Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtN PE=3 SV=1 202 504 3.0E-08
sp|P33224|AIDB_ECOLI Putative acyl-CoA dehydrogenase AidB OS=Escherichia coli (strain K12) GN=aidB PE=1 SV=3 231 501 5.0E-08
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 2 62 5.0E-08
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 5 62 7.0E-08
sp|Q4R749|FADS2_MACFA Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1 6 102 7.0E-08
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 7 62 7.0E-08
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 12 62 8.0E-08
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 7 73 9.0E-08
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 8 102 1.0E-07
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 8 102 1.0E-07
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 4 62 1.0E-07
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 12 112 1.0E-07
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 12 62 2.0E-07
sp|Q5R778|ACD11_PONAB Acyl-CoA dehydrogenase family member 11 OS=Pongo abelii GN=ACAD11 PE=2 SV=2 229 474 2.0E-07
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 4 111 2.0E-07
sp|Q8K1P9|FADS3_RAT Fatty acid desaturase 3 OS=Rattus norvegicus GN=Fads3 PE=2 SV=1 12 90 3.0E-07
sp|Q9Z0R9|FADS2_MOUSE Fatty acid desaturase 2 OS=Mus musculus GN=Fads2 PE=1 SV=1 12 91 3.0E-07
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 1 62 3.0E-07
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 9 73 3.0E-07
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 5 62 3.0E-07
sp|Q9Y5Q0|FADS3_HUMAN Fatty acid desaturase 3 OS=Homo sapiens GN=FADS3 PE=2 SV=1 6 90 3.0E-07
sp|Q9Z122|FADS2_RAT Fatty acid desaturase 2 OS=Rattus norvegicus GN=Fads2 PE=2 SV=1 12 91 3.0E-07
sp|Q8RWZ3|IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana GN=IBR3 PE=1 SV=1 226 505 3.0E-07
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 7 89 4.0E-07
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 1 62 4.0E-07
sp|Q9JJE7|FADS3_MOUSE Fatty acid desaturase 3 OS=Mus musculus GN=Fads3 PE=2 SV=2 12 90 4.0E-07
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 5 62 5.0E-07
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 7 66 5.0E-07
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 12 62 6.0E-07
sp|Q709F0|ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens GN=ACAD11 PE=1 SV=2 229 474 7.0E-07
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 6 62 7.0E-07
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 6 62 9.0E-07
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 12 62 9.0E-07
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 7 107 1.0E-06
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 4 62 1.0E-06
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 9 84 1.0E-06
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 1 66 2.0E-06
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 4 62 2.0E-06
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 2 66 3.0E-06
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 9 62 3.0E-06
sp|A8MWK0|FS2P1_HUMAN Putative fatty acid desaturase 2-like protein FADS2P1 OS=Homo sapiens GN=FADS2P1 PE=5 SV=2 4 90 4.0E-06
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 5 67 5.0E-06
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 13 66 7.0E-06
sp|A9SIZ6|D5FAD_PHYPA Acyl-lipid (8-3)-desaturase OS=Physcomitrella patens subsp. patens GN=DES5 PE=1 SV=1 4 211 8.0E-06
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 7 66 8.0E-06
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 7 66 9.0E-06
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 2 66 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|084050
MAAKQLRSLTREEVGKHNKDGDLWIIVDTKVYDVSRFKDVHPGGVSVLLDDDVAGQDATEAFYGLHKHEVIIKPQ
YARLQIGFIEGEQPTIRARDVGELSTVPYAEPTWLTPGCYSPYFTDNHRKFHKAVCKFNDEIILPDALAREEDGK
PPSQSVLEAMAKVNLHAMRMGPGKHLKGLELMGGIVKPEQFDYFHEMIITQELGRAGKRGYADGLMAGSLIGLPP
VLNFGSEEIKKKVIPEVLSGQKLICLAISEAFAGSDVAGLKTTARKTEDGKHWIINGTKKWITNGTYAHYFTVGC
RTKNGLTVILVERGDGVETKAIKTSYSPTAGTAYVTFDNVKVPVENTLGKEGQGIFIMLSNFNHERWVMACASVR
SQRRIVEDCLKWTNQRKVFGKPLHSQAVIRSKLAAMIARVESLQSWLEMITYQMNNMDYKQQASKLAGPIGLLKM
HATRTAQLTAADAVQIFGGRGITRTGMGEQIEHYHRTVTFDSILGGAEDVLGDLGVRQAIRNMPKNVRL*
Coding >AgabiH97|084050
ATGGCCGCCAAACAATTGAGATCGCTCACTCGAGAGGAAGTCGGTAAACATAATAAAGATGGTGATCTTTGGATT
ATTGTCGATACGAAGGTCTACGACGTTAGTAGATTCAAAGACGTCCATCCTGGAGGTGTTTCAGTTCTCCTAGAT
GACGATGTCGCTGGCCAAGACGCCACGGAGGCTTTCTATGGGCTTCACAAGCATGAAGTTATCATAAAGCCCCAG
TATGCTCGACTCCAAATCGGTTTCATTGAGGGAGAGCAACCTACCATCCGTGCTCGGGACGTTGGTGAACTCAGC
ACAGTGCCTTATGCGGAGCCCACTTGGTTGACTCCTGGCTGCTACAGCCCTTATTTCACCGATAACCATCGTAAA
TTTCACAAGGCAGTCTGCAAGTTCAATGATGAGATCATTTTGCCCGATGCGCTCGCAAGGGAAGAAGACGGAAAA
CCTCCTAGCCAGTCTGTCCTTGAAGCTATGGCCAAAGTCAACCTACACGCTATGCGCATGGGTCCCGGAAAGCAT
CTGAAAGGTTTAGAGCTCATGGGCGGCATCGTCAAGCCCGAACAATTTGATTATTTCCACGAAATGATAATCACT
CAAGAATTGGGTAGAGCGGGCAAACGTGGTTATGCCGATGGATTGATGGCCGGTTCTCTCATTGGCCTCCCTCCC
GTTCTCAACTTTGGTAGTGAAGAAATTAAGAAAAAAGTCATTCCTGAAGTATTGTCTGGGCAGAAGCTTATTTGT
CTTGCTATTTCCGAGGCCTTTGCAGGTAGCGATGTCGCCGGTCTGAAAACAACAGCCCGGAAGACCGAAGACGGA
AAACACTGGATCATCAACGGAACTAAAAAATGGATCACCAATGGAACCTATGCTCACTATTTCACCGTTGGATGT
CGTACAAAAAATGGTTTGACTGTTATCCTCGTTGAGAGAGGGGATGGAGTCGAAACTAAAGCCATCAAGACATCC
TACTCACCCACAGCTGGAACAGCATATGTGACCTTTGATAATGTCAAAGTGCCCGTAGAGAATACACTCGGCAAG
GAAGGTCAAGGAATTTTCATCATGCTCTCGAATTTCAATCACGAGCGTTGGGTCATGGCTTGTGCTTCCGTGCGC
TCGCAGAGACGTATTGTAGAGGATTGCTTAAAGTGGACGAACCAACGCAAGGTGTTTGGTAAACCCCTACACTCA
CAAGCCGTCATTCGAAGCAAACTTGCGGCTATGATTGCTCGCGTCGAAAGTCTTCAGAGCTGGCTGGAGATGATC
ACCTATCAGATGAACAACATGGATTATAAGCAACAAGCATCCAAGCTTGCTGGACCTATTGGCCTGTTGAAAATG
CACGCTACCCGGACAGCGCAGCTCACGGCGGCTGATGCTGTCCAAATATTTGGAGGTCGCGGTATAACAAGAACC
GGTATGGGCGAACAAATCGAGCATTATCACCGCACAGTGACATTTGATTCAATCCTTGGAGGAGCGGAAGACGTT
TTAGGAGATCTGGGTGTCCGTCAGGCAATCCGCAACATGCCTAAGAATGTCAGGCTTTAG
Transcript >AgabiH97|084050
ATGGCCGCCAAACAATTGAGATCGCTCACTCGAGAGGAAGTCGGTAAACATAATAAAGATGGTGATCTTTGGATT
ATTGTCGATACGAAGGTCTACGACGTTAGTAGATTCAAAGACGTCCATCCTGGAGGTGTTTCAGTTCTCCTAGAT
GACGATGTCGCTGGCCAAGACGCCACGGAGGCTTTCTATGGGCTTCACAAGCATGAAGTTATCATAAAGCCCCAG
TATGCTCGACTCCAAATCGGTTTCATTGAGGGAGAGCAACCTACCATCCGTGCTCGGGACGTTGGTGAACTCAGC
ACAGTGCCTTATGCGGAGCCCACTTGGTTGACTCCTGGCTGCTACAGCCCTTATTTCACCGATAACCATCGTAAA
TTTCACAAGGCAGTCTGCAAGTTCAATGATGAGATCATTTTGCCCGATGCGCTCGCAAGGGAAGAAGACGGAAAA
CCTCCTAGCCAGTCTGTCCTTGAAGCTATGGCCAAAGTCAACCTACACGCTATGCGCATGGGTCCCGGAAAGCAT
CTGAAAGGTTTAGAGCTCATGGGCGGCATCGTCAAGCCCGAACAATTTGATTATTTCCACGAAATGATAATCACT
CAAGAATTGGGTAGAGCGGGCAAACGTGGTTATGCCGATGGATTGATGGCCGGTTCTCTCATTGGCCTCCCTCCC
GTTCTCAACTTTGGTAGTGAAGAAATTAAGAAAAAAGTCATTCCTGAAGTATTGTCTGGGCAGAAGCTTATTTGT
CTTGCTATTTCCGAGGCCTTTGCAGGTAGCGATGTCGCCGGTCTGAAAACAACAGCCCGGAAGACCGAAGACGGA
AAACACTGGATCATCAACGGAACTAAAAAATGGATCACCAATGGAACCTATGCTCACTATTTCACCGTTGGATGT
CGTACAAAAAATGGTTTGACTGTTATCCTCGTTGAGAGAGGGGATGGAGTCGAAACTAAAGCCATCAAGACATCC
TACTCACCCACAGCTGGAACAGCATATGTGACCTTTGATAATGTCAAAGTGCCCGTAGAGAATACACTCGGCAAG
GAAGGTCAAGGAATTTTCATCATGCTCTCGAATTTCAATCACGAGCGTTGGGTCATGGCTTGTGCTTCCGTGCGC
TCGCAGAGACGTATTGTAGAGGATTGCTTAAAGTGGACGAACCAACGCAAGGTGTTTGGTAAACCCCTACACTCA
CAAGCCGTCATTCGAAGCAAACTTGCGGCTATGATTGCTCGCGTCGAAAGTCTTCAGAGCTGGCTGGAGATGATC
ACCTATCAGATGAACAACATGGATTATAAGCAACAAGCATCCAAGCTTGCTGGACCTATTGGCCTGTTGAAAATG
CACGCTACCCGGACAGCGCAGCTCACGGCGGCTGATGCTGTCCAAATATTTGGAGGTCGCGGTATAACAAGAACC
GGTATGGGCGAACAAATCGAGCATTATCACCGCACAGTGACATTTGATTCAATCCTTGGAGGAGCGGAAGACGTT
TTAGGAGATCTGGGTGTCCGTCAGGCAATCCGCAACATGCCTAAGAATGTCAGGCTTTAG
Gene >AgabiH97|084050
ATGGCCGCCAAACAATTGAGATCGCTCACTCGAGAGGAAGTCGGTAAAGTATGTGCTTTCTTGGTATCATGGGTA
GAAAGTCACAAAAACAGAAATAACTCCTATTTTAGCATAATAAAGATGGTGATCTTGTACGTATATATAGTCTTT
ATCAATATTCGACGACACTAACGCTCATCTTTACAGTGGATTATTGTCGATACGAAGGTCTACGACGTTAGTAGA
TTCAAAGACGTCCATCCTGGAGGTGTTTCAGTTCTCCTAGATGACGATGTCGGTACGCTACACTCACCAAGGTCG
TCTTGATACCCGCGTAACTAACGCTGTGCGCACAGCTGGCCAAGACGCCACGGAGGCTTTCTATGGGCTTCACAA
GCATGAAGTTATCATAAAGCCCCAGTATGCTCGACTCCAAATCGGTTTCATTGAGGGAGAGCAACCTACCATCCG
TGCTCGGGACGTTGGTGAACTCAGCACAGTGCCTTATGCGGAGCCCACTTGGTTGACTCCTGGCTGCTACAGCCC
TTATTTCACCGATGTCAGTTGAAGTTTTCATATTGTTGCGCATGAAACACTCACAAACGGAATGCAGAACCATCG
TAAATTTCACAAGGCAGTCTGCAAGTTCAATGATGAGATCATTTTGCCCGATGCGCTCGTATGTGGTTATTATTG
GGTATTGTAAAGCTTGTTAAAAATGACTGTTTTAAATAGGCAAGGGAAGAAGACGGAAAACCTCCTAGCCAGTCT
GTCCTTGAAGCTATGGCCAAAGTCAACCTACACGCTATGCGCATGGGTCCCGGAAAGCATCTGAAAGGTTTAGAG
CTCATGGGCGGCATCGTCAAGCCCGAACAATTTGATTATTTCCACGAAATGATAATCACTCAAGAATTGGGTAGA
GCGGGCAAACGTGGTTATGCCGATGGTAAGTTGGCACTTTGAAACTACCAGCGGAAGCTGACTAGTTTTTCATTA
GGATTGATGGCCGGTTCTCTCATTGGCCTCCCTCCCGTTCTCAACTTTGGTAGTGAAGAAATTAAGAAAAAAGTC
ATTCCTGAAGTATTGTCTGGGCAGAAGCTTATTTGTCTTGCTATTTCCGAGGCCTTTGCAGGTAGCGATGTCGCC
GGTCTGAAAACAACAGCCCGGAAGACCGAAGACGGAAAACACTGGATCATCAACGGAACGTGAGTATTTTCTGAC
CATGTCCTATATCGCTGCTTATGTCAATAAAAGTAAAAAATGGATCACCAATGGAACGTAAGTGACTGAACTCGT
ATTGATTAAGACCCAAACTCACCATCGTCTTTGGAAAATTCAGCTATGCTCACTAGTGCGTGACTCTACTTACAA
CGAATGAAATTGTCTGACGTATACTCAGTTTCACCGTTGGATGTCGTACAAAAAATGGTTTGACTGTTATCCTCG
TTGAGAGAGGGGATGGAGTCGAAACTAAAGCCATCAAGACATCCTACGTGCGTACAAGTTTCCTTTCTCCTCCCG
GATCACCTACTCATTCCATATACACCAGTCACCCACAGCTGGAACAGCATATGTGACCTTTGATAATGTCAAAGT
GCCCGTAGAGAATACACTCGGCAAGGAAGGTCAAGGAATTTTCATCATGCTCTCGAATTTCAATCACGAGCGTTG
GGTCATGGCTTGTGCTTCCGTGCGCTCGCAGAGACGTATTGTAGAGGATTGCTTAAAGTGGACGAACCAACGCAA
GGTGTTTGGTAAACCCCTACACTCACAAGCCGTCATTCGAAGCAAACTTGCGGCTATGATTGCTCGCGTCGAAAG
TCTTCAGAGCTGGCTGGAGATGATCACCTATCAGATGAACAACATGGTATGAGGTGTCTTATCTTTGTCCATAAC
CTTACGGCTTGACACACGTTATAGGATTATAAGCAACAAGCATCCAAGCTTGCTGGGTAGGCACAATTTCTAATG
AAGTGTTCTCAGTCGCTCAAAAATACTTACATAGACCTATTGGCCTGTTGAAAATGCACGCTACCCGGACAGCGC
AGCTCACGGCGGCTGATGCTGTCCAAATATTTGGAGGTCGCGGTATAACAAGAACCGGTATGGGCGAACAAATCG
AGCATGTAAGTCCCAATACATAGGTCAAGAATGAGGGACTTATTAACGTCTTCAGTATCACCGCACAGTGACATT
TGATTCGTAAGTAGTTCCCCACTACGTTTTAAAGCAACGTGACACTGAATTCACTTCAAAAGAATCCTTGGAGGA
GCGGAAGACGTTTTAGGAGATCTGGGTGTCCGTCAGGCAATCCGCAACATGCCTAAGAATGTCAGGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail