© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|083910 |
| Gene name | |
| Location | scaffold_5:1427803..1428496 |
| Strand | + |
| Gene length (bp) | 693 |
| Transcript length (bp) | 480 |
| Coding sequence length (bp) | 480 |
| Protein length (aa) | 160 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF04573 | SPC22 | Signal peptidase subunit | 2.5E-44 | 2 | 153 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12133|SPC3_YEAST | Signal peptidase complex subunit SPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC3 PE=1 SV=1 | 25 | 148 | 4.0E-21 |
| sp|Q6C4R5|SPC3_YARLI | Microsomal signal peptidase subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPC3 PE=3 SV=1 | 31 | 155 | 8.0E-19 |
| sp|P28687|SPCS3_CHICK | Signal peptidase complex subunit 3 OS=Gallus gallus GN=SPC22 PE=1 SV=1 | 42 | 138 | 2.0E-17 |
| sp|P61009|SPCS3_HUMAN | Signal peptidase complex subunit 3 OS=Homo sapiens GN=SPCS3 PE=1 SV=1 | 2 | 138 | 2.0E-17 |
| sp|P61008|SPCS3_CANLF | Signal peptidase complex subunit 3 OS=Canis lupus familiaris GN=SPCS3 PE=1 SV=1 | 2 | 138 | 2.0E-17 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12133|SPC3_YEAST | Signal peptidase complex subunit SPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC3 PE=1 SV=1 | 25 | 148 | 4.0E-21 |
| sp|Q6C4R5|SPC3_YARLI | Microsomal signal peptidase subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPC3 PE=3 SV=1 | 31 | 155 | 8.0E-19 |
| sp|P28687|SPCS3_CHICK | Signal peptidase complex subunit 3 OS=Gallus gallus GN=SPC22 PE=1 SV=1 | 42 | 138 | 2.0E-17 |
| sp|P61009|SPCS3_HUMAN | Signal peptidase complex subunit 3 OS=Homo sapiens GN=SPCS3 PE=1 SV=1 | 2 | 138 | 2.0E-17 |
| sp|P61008|SPCS3_CANLF | Signal peptidase complex subunit 3 OS=Canis lupus familiaris GN=SPCS3 PE=1 SV=1 | 2 | 138 | 2.0E-17 |
| sp|Q3SZU5|SPCS3_BOVIN | Signal peptidase complex subunit 3 OS=Bos taurus GN=SPCS3 PE=2 SV=1 | 2 | 138 | 2.0E-17 |
| sp|P34525|SPCS3_CAEEL | Probable signal peptidase complex subunit 3 OS=Caenorhabditis elegans GN=K12H4.4 PE=1 SV=1 | 1 | 153 | 7.0E-17 |
| sp|Q6BPD6|SPC3_DEBHA | Microsomal signal peptidase subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPC3 PE=3 SV=2 | 43 | 143 | 1.0E-16 |
| sp|Q53YF3|SPC3B_ARATH | Signal peptidase complex subunit 3B OS=Arabidopsis thaliana GN=At5g27430 PE=2 SV=1 | 1 | 136 | 1.0E-16 |
| sp|Q9MA96|SPC3A_ARATH | Signal peptidase complex subunit 3A OS=Arabidopsis thaliana GN=At3g05230 PE=2 SV=1 | 2 | 136 | 1.0E-16 |
| sp|Q9D365|SPCS3_MOUSE | Signal peptidase complex subunit 3 OS=Mus musculus GN=Spcs3 PE=1 SV=1 | 42 | 138 | 3.0E-16 |
| sp|Q568Z4|SPCS3_RAT | Signal peptidase complex subunit 3 OS=Rattus norvegicus GN=Spcs3 PE=2 SV=1 | 42 | 138 | 3.0E-16 |
| sp|Q60MW2|SPCS3_CAEBR | Probable signal peptidase complex subunit 3 OS=Caenorhabditis briggsae GN=CBG22979 PE=3 SV=1 | 1 | 154 | 4.0E-16 |
| sp|Q9VCA9|SPCS3_DROME | Signal peptidase complex subunit 3 OS=Drosophila melanogaster GN=Spase22-23 PE=2 SV=1 | 2 | 138 | 8.0E-16 |
| sp|Q6CRY8|SCP3_KLULA | Microsomal signal peptidase subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPC3 PE=3 SV=1 | 44 | 158 | 1.0E-13 |
| sp|Q10259|SPC3_SCHPO | Probable microsomal signal peptidase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc3 PE=3 SV=1 | 42 | 141 | 6.0E-13 |
| sp|B0G180|SPCS3_DICDI | Signal peptidase complex subunit 3 OS=Dictyostelium discoideum GN=spcs3 PE=3 SV=1 | 44 | 153 | 6.0E-13 |
| sp|Q9LGB4|SPCS3_ORYSJ | Probable signal peptidase complex subunit 3 OS=Oryza sativa subsp. japonica GN=Os01g0131800 PE=3 SV=2 | 66 | 144 | 3.0E-08 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0006465 | signal peptide processing | Yes |
| GO:0005787 | signal peptidase complex | Yes |
| GO:0016021 | integral component of membrane | Yes |
| GO:0006508 | proteolysis | No |
| GO:0016485 | protein processing | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:1905368 | peptidase complex | No |
| GO:0005575 | cellular_component | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0051604 | protein maturation | No |
| GO:0098796 | membrane protein complex | No |
| GO:0043603 | cellular amide metabolic process | No |
| GO:0019538 | protein metabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0006518 | peptide metabolic process | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:1902494 | catalytic complex | No |
| GO:0140534 | endoplasmic reticulum protein-containing complex | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0032991 | protein-containing complex | No |
| GO:0044238 | primary metabolic process | No |
| GO:0009987 | cellular process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0031224 | intrinsic component of membrane | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 17 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 124.44 | 66.97 | 181.92 |
| Initials | Initials knots | 92.75 | 50.45 | 135.04 |
| Pileal_Stipeal_center | Stage I stipe center | 201.96 | 118.92 | 285.00 |
| Pileal_Stipeal_shell | Stage I stipe shell | 289.84 | 169.17 | 410.52 |
| DIF_stipe_center | Stage II stipe center | 237.02 | 141.06 | 332.98 |
| DIF_stipe_shell | Stage II stipe shell | 162.27 | 94.45 | 230.09 |
| DIF_stipe_skin | Stage II stipe skin | 176.37 | 103.25 | 249.49 |
| DIF_cap_skin | Stage II cap skin | 357.69 | 214.44 | 500.94 |
| DIF_cap_tissue | Stage II cap tissue | 335.31 | 201.32 | 469.29 |
| DIF_gill_tissue | Stage II gill tissue | 321.66 | 193.32 | 450.00 |
| YFB_stipe_center | Young fruiting body stipe center | 185.88 | 106.50 | 265.25 |
| YFB_stipe_shell | Young fruiting body stipe shell | 148.43 | 85.33 | 211.54 |
| YFB_stipe_skin | Young fruiting body stipe skin | 152.73 | 87.70 | 217.75 |
| YFB_cap_skin | Young fruiting body cap skin | 363.10 | 218.42 | 507.78 |
| YFB_cap_tissue | Young fruiting body cap tissue | 246.28 | 146.62 | 345.95 |
| YFB_gill_tissue | Young fruiting body gill tissue | 283.77 | 169.98 | 397.56 |
| YFB_veil | Young fruiting body veil | 295.65 | 176.43 | 414.88 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.001140 | yes |
| Casing | YFB_stipe_center | 0.218974 | no |
| Casing | YFB_stipe_shell | 0.690614 | no |
| Casing | YFB_stipe_skin | 0.623687 | no |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.012880 | yes |
| Casing | YFB_gill_tissue | 0.002951 | yes |
| Casing | YFB_veil | 0.001140 | yes |
| Casing | Initials | 0.447840 | no |
| Casing | Pileal_Stipeal_center | 0.107449 | no |
| Casing | Pileal_Stipeal_shell | 0.001625 | yes |
| Casing | DIF_stipe_center | 0.021846 | yes |
| Casing | DIF_stipe_shell | 0.481618 | no |
| Casing | DIF_stipe_skin | 0.305777 | no |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.044418 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.002951 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.004548 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.778436 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.422433 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.771880 | no |
| DIF_gill_tissue | YFB_veil | 0.859742 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.559940 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.628241 | no |
| YFB_stipe_center | YFB_cap_skin | 0.009773 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.414862 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.151524 | no |
| YFB_stipe_center | YFB_veil | 0.109152 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.962188 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.083158 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.012577 | yes |
| YFB_stipe_shell | YFB_veil | 0.008457 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.108080 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.015529 | yes |
| YFB_stipe_skin | YFB_veil | 0.011041 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.195682 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.471364 | no |
| YFB_cap_skin | YFB_veil | 0.576559 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.735645 | no |
| YFB_cap_tissue | YFB_veil | 0.634084 | no |
| YFB_gill_tissue | YFB_veil | 0.936207 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.015529 | yes |
| Initials | YFB_stipe_shell | 0.138008 | no |
| Initials | YFB_stipe_skin | 0.109313 | no |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.000613 | yes |
| Initials | YFB_veil | 0.000613 | yes |
| Initials | Pileal_Stipeal_center | 0.002525 | yes |
| Initials | Pileal_Stipeal_shell | 0.000613 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.058926 | no |
| Initials | DIF_stipe_skin | 0.023676 | yes |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.087251 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.868986 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.353791 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.418538 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.021322 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.597420 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.260813 | no |
| Pileal_Stipeal_center | YFB_veil | 0.195079 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.241697 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.694670 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.554187 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.753919 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.027943 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.052346 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.818088 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.135591 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.013782 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.018624 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.530420 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.692202 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.969532 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.970472 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.594652 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.034837 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.081756 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.568482 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.727313 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.333433 | no |
| DIF_stipe_center | YFB_stipe_center | 0.501883 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.106507 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.139126 | no |
| DIF_stipe_center | YFB_cap_skin | 0.135150 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.944762 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.644350 | no |
| DIF_stipe_center | YFB_veil | 0.538230 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.215960 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.377754 | no |
| DIF_stipe_center | DIF_cap_skin | 0.147277 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.246828 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.008121 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.762045 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.860444 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.910430 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.001625 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.160642 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.032038 | yes |
| DIF_stipe_shell | YFB_veil | 0.022631 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.864441 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.002084 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.005302 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.016104 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.923071 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.679455 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.743415 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.003365 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.295336 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.088269 | no |
| DIF_stipe_skin | YFB_veil | 0.059712 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.004548 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.010412 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.811310 | no |
| DIF_cap_skin | YFB_stipe_center | 0.014668 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.001140 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.977185 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.212482 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.503895 | no |
| DIF_cap_skin | YFB_veil | 0.611715 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.896068 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.934576 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.025963 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.001625 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.865077 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.333265 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.670730 | no |
| DIF_cap_tissue | YFB_veil | 0.771266 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|083910 MMALLAAIALSSFVFTADPKGELGLLSVKVYPASAAKKVYPKQELAFVNFNVTADLTPLFHWNTKQLFVWVEAEF NNTKRAENAVVIWDRIVRRKEDANLKVAGKNKYMLRELTKNFKHAKPAHYTLKYNVMPYVGVLTYGEAARTKTPV EFPPVQQRV* |
| Coding | >AgabiH97|083910 ATGATGGCTCTCTTGGCTGCCATTGCACTTTCCTCATTCGTATTCACCGCAGACCCGAAAGGCGAGCTAGGATTG CTTTCCGTAAAAGTTTATCCAGCATCAGCCGCAAAGAAGGTGTACCCAAAGCAGGAGCTCGCGTTTGTCAACTTC AATGTTACAGCTGATCTCACCCCCCTTTTTCATTGGAATACTAAGCAACTTTTCGTCTGGGTGGAGGCAGAGTTC AACAACACCAAACGGGCTGAGAATGCTGTCGTTATCTGGGATCGTATAGTACGTCGTAAAGAGGATGCCAACTTG AAAGTAGCGGGCAAGAACAAATACATGCTCCGCGAACTCACCAAGAATTTCAAGCATGCGAAACCGGCCCATTAT ACCCTGAAATACAATGTGATGCCTTATGTTGGAGTGCTAACGTATGGTGAAGCAGCAAGGACAAAAACCCCAGTC GAATTTCCTCCTGTTCAACAACGTGTATAA |
| Transcript | >AgabiH97|083910 ATGATGGCTCTCTTGGCTGCCATTGCACTTTCCTCATTCGTATTCACCGCAGACCCGAAAGGCGAGCTAGGATTG CTTTCCGTAAAAGTTTATCCAGCATCAGCCGCAAAGAAGGTGTACCCAAAGCAGGAGCTCGCGTTTGTCAACTTC AATGTTACAGCTGATCTCACCCCCCTTTTTCATTGGAATACTAAGCAACTTTTCGTCTGGGTGGAGGCAGAGTTC AACAACACCAAACGGGCTGAGAATGCTGTCGTTATCTGGGATCGTATAGTACGTCGTAAAGAGGATGCCAACTTG AAAGTAGCGGGCAAGAACAAATACATGCTCCGCGAACTCACCAAGAATTTCAAGCATGCGAAACCGGCCCATTAT ACCCTGAAATACAATGTGATGCCTTATGTTGGAGTGCTAACGTATGGTGAAGCAGCAAGGACAAAAACCCCAGTC GAATTTCCTCCTGTTCAACAACGTGTATAA |
| Gene | >AgabiH97|083910 ATGATGGCTCTCTTGGCTGCCATTGCACTTTCCTCATTCGTATTCACCGCAGACCCGAAAGGCGAGCTAGGATTG CTTTCCGTAAAAGTGTGCGTCCATGAAATGTCAGTCGCTGTTCCACACCTCTGACTTGTATCCTTCGTAGTTATC CAGCATCAGCCGCAAAGAAGGTGTACCCAAAGCAGGAGCTCGCGTTTGTCAACTTCAATGTTACAGCTGGTTTGT TCTTCCATGCTACTCGTGTTACCGCTGAGATCCAATTCTAATTGCATTAGATCTCACCCCCCTTTTTCATTGGAA TACTAAGCAACTTTTCGTCTGGGTGGAGGCAGAGTTCAACAACACCAAACGGGTTAGTTTCTAATCACCTTTATT AGCTAAATAATCTCCTGACGTGGACGCAGGCTGAGAATGCTGTCGTTATCTGGGATCGTATAGTACGTCGTAAAG AGGATGCCAACTTGAAAGTAGCGGGCAAGAACAAATACATGCTCCGCGAACTCACCAAGAATTTCAAGTACGTCA CATCCAGGTCACGCTGAGGCCCAAGAGCTGATCATCGTTAGGCATGCGAAACCGGCCCATTATACCCTGAAATAC AATGTGATGCCTTATGTTGGAGTGCTAACGTATGGTGAAGCAGCAAGGACAAAAACCCCAGTCGAATTTCCTCCT GTTCAACAACGTGTATAA |