Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|083910
Gene name
Locationscaffold_5:1427803..1428496
Strand+
Gene length (bp)693
Transcript length (bp)480
Coding sequence length (bp)480
Protein length (aa) 160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04573 SPC22 Signal peptidase subunit 2.5E-44 2 153

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12133|SPC3_YEAST Signal peptidase complex subunit SPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC3 PE=1 SV=1 25 148 4.0E-21
sp|Q6C4R5|SPC3_YARLI Microsomal signal peptidase subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPC3 PE=3 SV=1 31 155 8.0E-19
sp|P28687|SPCS3_CHICK Signal peptidase complex subunit 3 OS=Gallus gallus GN=SPC22 PE=1 SV=1 42 138 2.0E-17
sp|P61009|SPCS3_HUMAN Signal peptidase complex subunit 3 OS=Homo sapiens GN=SPCS3 PE=1 SV=1 2 138 2.0E-17
sp|P61008|SPCS3_CANLF Signal peptidase complex subunit 3 OS=Canis lupus familiaris GN=SPCS3 PE=1 SV=1 2 138 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12133|SPC3_YEAST Signal peptidase complex subunit SPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC3 PE=1 SV=1 25 148 4.0E-21
sp|Q6C4R5|SPC3_YARLI Microsomal signal peptidase subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPC3 PE=3 SV=1 31 155 8.0E-19
sp|P28687|SPCS3_CHICK Signal peptidase complex subunit 3 OS=Gallus gallus GN=SPC22 PE=1 SV=1 42 138 2.0E-17
sp|P61009|SPCS3_HUMAN Signal peptidase complex subunit 3 OS=Homo sapiens GN=SPCS3 PE=1 SV=1 2 138 2.0E-17
sp|P61008|SPCS3_CANLF Signal peptidase complex subunit 3 OS=Canis lupus familiaris GN=SPCS3 PE=1 SV=1 2 138 2.0E-17
sp|Q3SZU5|SPCS3_BOVIN Signal peptidase complex subunit 3 OS=Bos taurus GN=SPCS3 PE=2 SV=1 2 138 2.0E-17
sp|P34525|SPCS3_CAEEL Probable signal peptidase complex subunit 3 OS=Caenorhabditis elegans GN=K12H4.4 PE=1 SV=1 1 153 7.0E-17
sp|Q6BPD6|SPC3_DEBHA Microsomal signal peptidase subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPC3 PE=3 SV=2 43 143 1.0E-16
sp|Q53YF3|SPC3B_ARATH Signal peptidase complex subunit 3B OS=Arabidopsis thaliana GN=At5g27430 PE=2 SV=1 1 136 1.0E-16
sp|Q9MA96|SPC3A_ARATH Signal peptidase complex subunit 3A OS=Arabidopsis thaliana GN=At3g05230 PE=2 SV=1 2 136 1.0E-16
sp|Q9D365|SPCS3_MOUSE Signal peptidase complex subunit 3 OS=Mus musculus GN=Spcs3 PE=1 SV=1 42 138 3.0E-16
sp|Q568Z4|SPCS3_RAT Signal peptidase complex subunit 3 OS=Rattus norvegicus GN=Spcs3 PE=2 SV=1 42 138 3.0E-16
sp|Q60MW2|SPCS3_CAEBR Probable signal peptidase complex subunit 3 OS=Caenorhabditis briggsae GN=CBG22979 PE=3 SV=1 1 154 4.0E-16
sp|Q9VCA9|SPCS3_DROME Signal peptidase complex subunit 3 OS=Drosophila melanogaster GN=Spase22-23 PE=2 SV=1 2 138 8.0E-16
sp|Q6CRY8|SCP3_KLULA Microsomal signal peptidase subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPC3 PE=3 SV=1 44 158 1.0E-13
sp|Q10259|SPC3_SCHPO Probable microsomal signal peptidase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc3 PE=3 SV=1 42 141 6.0E-13
sp|B0G180|SPCS3_DICDI Signal peptidase complex subunit 3 OS=Dictyostelium discoideum GN=spcs3 PE=3 SV=1 44 153 6.0E-13
sp|Q9LGB4|SPCS3_ORYSJ Probable signal peptidase complex subunit 3 OS=Oryza sativa subsp. japonica GN=Os01g0131800 PE=3 SV=2 66 144 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006465 signal peptide processing Yes
GO:0005787 signal peptidase complex Yes
GO:0016021 integral component of membrane Yes
GO:0006508 proteolysis No
GO:0016485 protein processing No
GO:0110165 cellular anatomical entity No
GO:1905368 peptidase complex No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0051604 protein maturation No
GO:0098796 membrane protein complex No
GO:0043603 cellular amide metabolic process No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|083910
MMALLAAIALSSFVFTADPKGELGLLSVKVYPASAAKKVYPKQELAFVNFNVTADLTPLFHWNTKQLFVWVEAEF
NNTKRAENAVVIWDRIVRRKEDANLKVAGKNKYMLRELTKNFKHAKPAHYTLKYNVMPYVGVLTYGEAARTKTPV
EFPPVQQRV*
Coding >AgabiH97|083910
ATGATGGCTCTCTTGGCTGCCATTGCACTTTCCTCATTCGTATTCACCGCAGACCCGAAAGGCGAGCTAGGATTG
CTTTCCGTAAAAGTTTATCCAGCATCAGCCGCAAAGAAGGTGTACCCAAAGCAGGAGCTCGCGTTTGTCAACTTC
AATGTTACAGCTGATCTCACCCCCCTTTTTCATTGGAATACTAAGCAACTTTTCGTCTGGGTGGAGGCAGAGTTC
AACAACACCAAACGGGCTGAGAATGCTGTCGTTATCTGGGATCGTATAGTACGTCGTAAAGAGGATGCCAACTTG
AAAGTAGCGGGCAAGAACAAATACATGCTCCGCGAACTCACCAAGAATTTCAAGCATGCGAAACCGGCCCATTAT
ACCCTGAAATACAATGTGATGCCTTATGTTGGAGTGCTAACGTATGGTGAAGCAGCAAGGACAAAAACCCCAGTC
GAATTTCCTCCTGTTCAACAACGTGTATAA
Transcript >AgabiH97|083910
ATGATGGCTCTCTTGGCTGCCATTGCACTTTCCTCATTCGTATTCACCGCAGACCCGAAAGGCGAGCTAGGATTG
CTTTCCGTAAAAGTTTATCCAGCATCAGCCGCAAAGAAGGTGTACCCAAAGCAGGAGCTCGCGTTTGTCAACTTC
AATGTTACAGCTGATCTCACCCCCCTTTTTCATTGGAATACTAAGCAACTTTTCGTCTGGGTGGAGGCAGAGTTC
AACAACACCAAACGGGCTGAGAATGCTGTCGTTATCTGGGATCGTATAGTACGTCGTAAAGAGGATGCCAACTTG
AAAGTAGCGGGCAAGAACAAATACATGCTCCGCGAACTCACCAAGAATTTCAAGCATGCGAAACCGGCCCATTAT
ACCCTGAAATACAATGTGATGCCTTATGTTGGAGTGCTAACGTATGGTGAAGCAGCAAGGACAAAAACCCCAGTC
GAATTTCCTCCTGTTCAACAACGTGTATAA
Gene >AgabiH97|083910
ATGATGGCTCTCTTGGCTGCCATTGCACTTTCCTCATTCGTATTCACCGCAGACCCGAAAGGCGAGCTAGGATTG
CTTTCCGTAAAAGTGTGCGTCCATGAAATGTCAGTCGCTGTTCCACACCTCTGACTTGTATCCTTCGTAGTTATC
CAGCATCAGCCGCAAAGAAGGTGTACCCAAAGCAGGAGCTCGCGTTTGTCAACTTCAATGTTACAGCTGGTTTGT
TCTTCCATGCTACTCGTGTTACCGCTGAGATCCAATTCTAATTGCATTAGATCTCACCCCCCTTTTTCATTGGAA
TACTAAGCAACTTTTCGTCTGGGTGGAGGCAGAGTTCAACAACACCAAACGGGTTAGTTTCTAATCACCTTTATT
AGCTAAATAATCTCCTGACGTGGACGCAGGCTGAGAATGCTGTCGTTATCTGGGATCGTATAGTACGTCGTAAAG
AGGATGCCAACTTGAAAGTAGCGGGCAAGAACAAATACATGCTCCGCGAACTCACCAAGAATTTCAAGTACGTCA
CATCCAGGTCACGCTGAGGCCCAAGAGCTGATCATCGTTAGGCATGCGAAACCGGCCCATTATACCCTGAAATAC
AATGTGATGCCTTATGTTGGAGTGCTAACGTATGGTGAAGCAGCAAGGACAAAAACCCCAGTCGAATTTCCTCCT
GTTCAACAACGTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail