Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|083780
Gene name
Locationscaffold_5:1386669..1388897
Strand+
Gene length (bp)2228
Transcript length (bp)2109
Coding sequence length (bp)2109
Protein length (aa) 703

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00330 Aconitase Aconitase family (aconitate hydratase) 7.4E-94 129 449
PF00694 Aconitase_C Aconitase C-terminal domain 1.6E-20 494 620

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM02|LYS4_CRYNJ Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LYS4 PE=3 SV=1 15 694 0.0E+00
sp|P0CM03|LYS4_CRYNB Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LYS4 PE=3 SV=1 15 694 0.0E+00
sp|Q4P521|LYS4_USTMA Homoaconitase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LYS4 PE=3 SV=2 4 698 0.0E+00
sp|Q2HZ33|LYS4_CANPA Homoaconitase, mitochondrial OS=Candida parapsilosis GN=LYS4 PE=3 SV=1 14 699 0.0E+00
sp|Q6BM98|LYS4_DEBHA Homoaconitase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LYS4 PE=3 SV=1 29 699 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM02|LYS4_CRYNJ Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LYS4 PE=3 SV=1 15 694 0.0E+00
sp|P0CM03|LYS4_CRYNB Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LYS4 PE=3 SV=1 15 694 0.0E+00
sp|Q4P521|LYS4_USTMA Homoaconitase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LYS4 PE=3 SV=2 4 698 0.0E+00
sp|Q2HZ33|LYS4_CANPA Homoaconitase, mitochondrial OS=Candida parapsilosis GN=LYS4 PE=3 SV=1 14 699 0.0E+00
sp|Q6BM98|LYS4_DEBHA Homoaconitase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LYS4 PE=3 SV=1 29 699 0.0E+00
sp|Q5A644|LYS4_CANAL Homoaconitase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LYS4 PE=3 SV=1 15 701 0.0E+00
sp|Q6C791|LYS4_YARLI Homoaconitase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS4 PE=3 SV=1 26 698 0.0E+00
sp|Q9UT74|LYS4_SCHPO Homoaconitase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys2 PE=3 SV=1 6 698 0.0E+00
sp|Q6CT61|LYS4_KLULA Homoaconitase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LYS4 PE=3 SV=1 1 698 0.0E+00
sp|P49367|LYS4_YEAST Homoaconitase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS4 PE=1 SV=1 7 698 0.0E+00
sp|Q4WUL6|LYS4_ASPFU Homoaconitase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lys4 PE=2 SV=1 26 698 0.0E+00
sp|Q4HVQ9|LYS4_GIBZE Homoaconitase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LYS4 PE=3 SV=1 28 700 0.0E+00
sp|Q92412|LYS4_EMENI Homoaconitase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lys4 PE=3 SV=2 28 700 0.0E+00
sp|Q6FM51|LYS4_CANGA Homoaconitase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS4 PE=3 SV=1 14 698 0.0E+00
sp|Q2GN26|LYS4_CHAGB Homoaconitase, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LYS4 PE=3 SV=1 22 698 0.0E+00
sp|Q58FL6|LYS4_ASPNC Homoaconitase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lysA PE=3 SV=1 16 700 0.0E+00
sp|Q2U9G3|LYS4_ASPOR Homoaconitase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lys4 PE=3 SV=1 28 700 0.0E+00
sp|Q75DX9|LYS4_ASHGO Homoaconitase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS4 PE=3 SV=2 14 694 0.0E+00
sp|Q870W1|LYS4_NEUCR Homoaconitase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lys-4 PE=3 SV=1 26 454 9.0E-166
sp|Q9WZ24|LEUC2_THEMA 3-isopropylmalate dehydratase large subunit 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC2 PE=3 SV=1 29 457 2.0E-70
sp|Q8U2A1|LEUC1_PYRFU 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuC1 PE=3 SV=1 29 457 3.0E-65
sp|Q9UZ07|LEUC1_PYRAB 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuC1 PE=3 SV=1 29 457 2.0E-64
sp|O28084|LEUC2_ARCFU 3-isopropylmalate dehydratase large subunit 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC2 PE=3 SV=1 29 457 5.0E-64
sp|Q6L0K5|LEUC_PICTO 3-isopropylmalate dehydratase large subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=leuC PE=3 SV=1 29 457 8.0E-64
sp|Q8TVF2|LEUC1_METKA 3-isopropylmalate dehydratase large subunit 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC1 PE=3 SV=1 29 454 9.0E-64
sp|B4U7U5|LEUC_HYDS0 3-isopropylmalate dehydratase large subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=leuC PE=3 SV=1 29 462 4.0E-63
sp|A4XJ48|LEUC_CALS8 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=leuC PE=3 SV=1 28 457 5.0E-63
sp|A5MZ75|LEUC_CLOK5 3-isopropylmalate dehydratase large subunit OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuC PE=3 SV=1 29 457 9.0E-63
sp|Q7VH31|LEUC_HELHP 3-isopropylmalate dehydratase large subunit OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuC PE=3 SV=1 49 457 1.0E-62
sp|B2KBD7|LEUC_ELUMP 3-isopropylmalate dehydratase large subunit OS=Elusimicrobium minutum (strain Pei191) GN=leuC PE=3 SV=1 28 457 5.0E-62
sp|Q9WYC7|LEUC1_THEMA 3-isopropylmalate dehydratase large subunit 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC1 PE=3 SV=1 29 457 1.0E-61
sp|B9MLV4|LEUC_CALBD 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=leuC PE=3 SV=1 28 457 1.0E-61
sp|Q58409|HACA_METJA Methanogen homoaconitase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hacA PE=1 SV=1 29 451 2.0E-61
sp|Q2LWJ2|LEUC_SYNAS 3-isopropylmalate dehydratase large subunit OS=Syntrophus aciditrophicus (strain SB) GN=leuC PE=3 SV=1 29 457 5.0E-61
sp|Q30NZ0|LEUC_SULDN 3-isopropylmalate dehydratase large subunit OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuC PE=3 SV=1 29 454 6.0E-61
sp|B0K0Y2|LEUC_THEPX 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter sp. (strain X514) GN=leuC PE=3 SV=1 46 458 6.0E-61
sp|Q8RDK2|LEUC_CALS4 3-isopropylmalate dehydratase large subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuC PE=3 SV=1 46 458 1.0E-60
sp|O67078|LEUC_AQUAE 3-isopropylmalate dehydratase large subunit OS=Aquifex aeolicus (strain VF5) GN=leuC PE=3 SV=1 30 457 1.0E-60
sp|O27668|HACA_METTH Probable methanogen homoaconitase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hacA PE=3 SV=1 31 454 2.0E-60
sp|Q0QLE2|DMDA_EUBBA 2,3-dimethylmalate dehydratase large subunit OS=Eubacterium barkeri GN=dmdA PE=1 SV=1 49 457 2.0E-60
sp|B8J4F9|LEUC_DESDA 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=leuC PE=3 SV=1 29 457 2.0E-60
sp|Q18AJ2|LEUC_PEPD6 3-isopropylmalate dehydratase large subunit OS=Peptoclostridium difficile (strain 630) GN=leuC PE=3 SV=1 29 457 3.0E-60
sp|B8CX22|LEUC_HALOH 3-isopropylmalate dehydratase large subunit OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuC PE=3 SV=1 30 457 4.0E-60
sp|Q726X4|LEUC_DESVH 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuC PE=3 SV=1 29 457 4.0E-60
sp|A1VAE7|LEUC_DESVV 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuC PE=3 SV=1 29 457 1.0E-59
sp|Q8TQZ3|LEUC_METAC Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuC PE=3 SV=1 29 457 2.0E-59
sp|B0KAH5|LEUC_THEP3 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=leuC PE=3 SV=1 46 457 4.0E-59
sp|B2V844|LEUC_SULSY 3-isopropylmalate dehydratase large subunit OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=leuC PE=3 SV=1 29 457 3.0E-58
sp|O28316|LEUC1_ARCFU 3-isopropylmalate dehydratase large subunit 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC1 PE=3 SV=2 29 457 3.0E-58
sp|Q8PUG1|LEUC_METMA Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuC PE=3 SV=2 29 457 3.0E-58
sp|A3DHI4|LEUC_CLOTH 3-isopropylmalate dehydratase large subunit OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuC PE=3 SV=1 29 457 4.0E-58
sp|B0TCR2|LEUC_HELMI 3-isopropylmalate dehydratase large subunit OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuC PE=3 SV=1 29 458 4.0E-58
sp|Q24XT4|LEUC_DESHY 3-isopropylmalate dehydratase large subunit OS=Desulfitobacterium hafniense (strain Y51) GN=leuC PE=3 SV=2 30 457 5.0E-58
sp|Q97EE0|LEUC_CLOAB 3-isopropylmalate dehydratase large subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuC PE=3 SV=1 26 457 1.0E-57
sp|O27439|LEUC_METTH Probable 3-isopropylmalate dehydratase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuC PE=3 SV=1 29 457 2.0E-57
sp|A6LPX4|LEUC_CLOB8 3-isopropylmalate dehydratase large subunit OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=leuC PE=3 SV=1 29 454 2.0E-57
sp|Q1AVC5|LEUC2_RUBXD 3-isopropylmalate dehydratase large subunit 2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC2 PE=3 SV=1 28 459 4.0E-57
sp|Q30WD3|LEUC_DESAG 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio alaskensis (strain G20) GN=leuC PE=3 SV=1 29 457 1.0E-56
sp|A8EQZ0|LEUC_ARCB4 3-isopropylmalate dehydratase large subunit OS=Arcobacter butzleri (strain RM4018) GN=leuC PE=3 SV=1 29 457 1.0E-56
sp|B2UYH6|LEUC_CLOBA 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=leuC PE=3 SV=1 29 454 2.0E-56
sp|Q2RG98|LEUC_MOOTA 3-isopropylmalate dehydratase large subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=leuC PE=3 SV=1 30 457 1.0E-55
sp|A6Q5L6|LEUC_NITSB 3-isopropylmalate dehydratase large subunit OS=Nitratiruptor sp. (strain SB155-2) GN=leuC PE=3 SV=1 29 457 3.0E-55
sp|B8DM92|LEUC_DESVM 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=leuC PE=3 SV=1 29 436 2.0E-54
sp|B2TIQ9|LEUC_CLOBB 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=leuC PE=3 SV=1 49 455 2.0E-54
sp|A9KT79|LEUC_CLOPH 3-isopropylmalate dehydratase large subunit OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=leuC PE=3 SV=1 29 459 4.0E-54
sp|B9L6Y8|LEUC_NAUPA 3-isopropylmalate dehydratase large subunit OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=leuC PE=3 SV=1 28 457 5.0E-54
sp|Q9ZNE0|HACA_THET2 Homoaconitase large subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hacA PE=1 SV=1 29 454 5.0E-54
sp|B8FMM4|LEUC_DESAA 3-isopropylmalate dehydratase large subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=leuC PE=3 SV=1 29 457 6.0E-54
sp|A7ZFP0|LEUC_CAMC1 3-isopropylmalate dehydratase large subunit OS=Campylobacter concisus (strain 13826) GN=leuC PE=3 SV=1 29 457 5.0E-53
sp|A6Q6J8|LEUC_SULNB 3-isopropylmalate dehydratase large subunit OS=Sulfurovum sp. (strain NBC37-1) GN=leuC PE=3 SV=1 29 457 1.0E-52
sp|B1H0A6|LEUC_UNCTG 3-isopropylmalate dehydratase large subunit OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=leuC PE=3 SV=1 29 457 1.0E-52
sp|Q9RTI6|LEUC2_DEIRA 3-isopropylmalate dehydratase large subunit 2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC2 PE=3 SV=1 30 459 2.0E-52
sp|A7HZP6|LEUC_CAMHC 3-isopropylmalate dehydratase large subunit OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=leuC PE=3 SV=1 29 454 8.0E-52
sp|A7IA28|LEUC_METB6 3-isopropylmalate dehydratase large subunit OS=Methanoregula boonei (strain 6A8) GN=leuC PE=3 SV=1 30 457 1.0E-51
sp|B5YKE0|LEUC_THEYD 3-isopropylmalate dehydratase large subunit OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=leuC PE=3 SV=1 29 457 1.0E-51
sp|P81291|LEUC_METJA Isopropylmalate/citramalate isomerase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuC PE=1 SV=1 30 457 3.0E-51
sp|Q4JC09|LEUC_SULAC 3-isopropylmalate dehydratase large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuC PE=3 SV=1 28 457 2.0E-50
sp|A0RMG7|LEUC_CAMFF 3-isopropylmalate dehydratase large subunit OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=leuC PE=3 SV=1 29 457 7.0E-50
sp|Q7M9Z9|LEUC_WOLSU 3-isopropylmalate dehydratase large subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuC PE=3 SV=1 29 457 1.0E-49
sp|A7H0L8|LEUC_CAMC5 3-isopropylmalate dehydratase large subunit OS=Campylobacter curvus (strain 525.92) GN=leuC PE=3 SV=1 29 457 3.0E-48
sp|Q74BX5|LEUC_GEOSL 3-isopropylmalate dehydratase large subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuC PE=3 SV=1 29 454 3.0E-47
sp|P55251|LEUC_RHIPU 3-isopropylmalate dehydratase OS=Rhizomucor pusillus GN=LEUA PE=3 SV=1 129 632 1.0E-46
sp|Q8TLF1|HACA_METAC Probable methanogen homoaconitase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hacA PE=3 SV=1 30 428 6.0E-46
sp|A4WMI6|LEUC_PYRAR 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=leuC PE=3 SV=1 46 454 8.0E-46
sp|Q8PZT3|HACA_METMA Probable methanogen homoaconitase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hacA PE=3 SV=1 60 428 1.0E-45
sp|A4YF03|LEUC_METS5 3-isopropylmalate dehydratase large subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuC PE=3 SV=1 30 457 4.0E-45
sp|Q39W70|LEUC_GEOMG 3-isopropylmalate dehydratase large subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuC PE=3 SV=1 56 454 7.0E-45
sp|Q8ZW41|LEUC_PYRAE 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuC PE=3 SV=1 46 454 9.0E-45
sp|A9A043|LEUC_DESOH 3-isopropylmalate dehydratase large subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=leuC PE=3 SV=1 29 428 2.0E-44
sp|A1RVH3|LEUC_PYRIL 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=leuC PE=3 SV=1 52 454 3.0E-44
sp|A9B805|LEUC_HERA2 3-isopropylmalate dehydratase large subunit OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=leuC PE=3 SV=1 29 461 4.0E-44
sp|Q74ZM9|LEUC_ASHGO 3-isopropylmalate dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEU1 PE=3 SV=2 129 623 7.0E-44
sp|B5EHU2|LEUC_GEOBB 3-isopropylmalate dehydratase large subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=leuC PE=3 SV=1 62 454 8.0E-44
sp|P18250|LEUC_PHYB8 3-isopropylmalate dehydratase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=leu1 PE=3 SV=2 129 662 1.0E-43
sp|Q974R0|LEUC_SULTO 3-isopropylmalate dehydratase large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuC PE=3 SV=1 28 454 1.0E-43
sp|O14289|LEUC_SCHPO 3-isopropylmalate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu2 PE=1 SV=1 27 629 2.0E-43
sp|P55811|LEUC_RHINI 3-isopropylmalate dehydratase OS=Rhizopus niveus GN=LEU1 PE=3 SV=1 129 634 2.0E-43
sp|Q938C9|LEUC_MYCS2 3-isopropylmalate dehydratase large subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=leuC PE=3 SV=1 29 451 2.0E-43
sp|A8MDY8|LEUC_CALMQ 3-isopropylmalate dehydratase large subunit OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=leuC PE=3 SV=1 30 454 8.0E-43
sp|A5G7U4|LEUC_GEOUR 3-isopropylmalate dehydratase large subunit OS=Geobacter uraniireducens (strain Rf4) GN=leuC PE=3 SV=1 29 454 9.0E-43
sp|Q00464|LEUC_CANMA 3-isopropylmalate dehydratase OS=Candida maltosa GN=LEU1 PE=3 SV=1 129 637 1.0E-42
sp|Q4WBR0|ACON3_ASPFU Putative aconitate hydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoC PE=2 SV=1 129 653 2.0E-42
sp|Q5KWJ5|LEUC_GEOKA 3-isopropylmalate dehydratase large subunit OS=Geobacillus kaustophilus (strain HTA426) GN=leuC PE=3 SV=1 28 459 3.0E-42
sp|Q97VY2|LEUC_SULSO 3-isopropylmalate dehydratase large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuC PE=3 SV=1 29 454 4.0E-42
sp|A7Z7B6|LEUC_BACMF 3-isopropylmalate dehydratase large subunit OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuC PE=3 SV=1 28 451 5.0E-42
sp|C5D5L8|LEUC_GEOSW 3-isopropylmalate dehydratase large subunit OS=Geobacillus sp. (strain WCH70) GN=leuC PE=3 SV=1 28 451 6.0E-42
sp|B1YD98|LEUC_PYRNV 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=leuC PE=3 SV=1 46 454 6.0E-42
sp|A3MWJ4|LEUC_PYRCJ 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=leuC PE=3 SV=1 46 454 8.0E-42
sp|A7NJH2|LEUC_ROSCS 3-isopropylmalate dehydratase large subunit OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=leuC PE=3 SV=1 129 454 2.0E-41
sp|Q870W1|LYS4_NEUCR Homoaconitase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lys-4 PE=3 SV=1 490 700 5.0E-41
sp|A5UUP5|LEUC_ROSS1 3-isopropylmalate dehydratase large subunit OS=Roseiflexus sp. (strain RS-1) GN=leuC PE=3 SV=1 129 454 6.0E-41
sp|A4IRH6|LEUC_GEOTN 3-isopropylmalate dehydratase large subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuC PE=3 SV=2 28 460 9.0E-41
sp|P80858|LEUC_BACSU 3-isopropylmalate dehydratase large subunit OS=Bacillus subtilis (strain 168) GN=leuC PE=1 SV=1 28 451 1.0E-40
sp|Q65GJ0|LEUC_BACLD 3-isopropylmalate dehydratase large subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuC PE=3 SV=1 28 449 2.0E-40
sp|P07264|LEUC_YEAST 3-isopropylmalate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU1 PE=1 SV=3 25 617 2.0E-40
sp|Q9RTY9|LEUC1_DEIRA 3-isopropylmalate dehydratase large subunit 1 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC1 PE=3 SV=1 129 457 3.0E-40
sp|Q8FPR3|LEUC_COREF 3-isopropylmalate dehydratase large subunit OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuC PE=3 SV=1 129 457 4.0E-40
sp|A0LVA3|LEUC_ACIC1 3-isopropylmalate dehydratase large subunit OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=leuC PE=3 SV=1 21 458 4.0E-40
sp|Q5YRY0|LEUC_NOCFA 3-isopropylmalate dehydratase large subunit OS=Nocardia farcinica (strain IFM 10152) GN=leuC PE=3 SV=1 28 458 5.0E-40
sp|O59391|LEUC_PYRHO 3-isopropylmalate dehydratase large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuC PE=3 SV=1 50 454 5.0E-40
sp|A8M5I3|LEUC_SALAI 3-isopropylmalate dehydratase large subunit OS=Salinispora arenicola (strain CNS-205) GN=leuC PE=3 SV=1 129 457 7.0E-40
sp|A4QDS8|LEUC_CORGB 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain R) GN=leuC PE=3 SV=1 129 457 9.0E-40
sp|P49601|LEUC_USTMA 3-isopropylmalate dehydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEU1 PE=3 SV=1 129 636 1.0E-39
sp|P58946|LEUC_CORGL 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuC PE=2 SV=1 129 457 2.0E-39
sp|Q9K8F0|LEUC_BACHD 3-isopropylmalate dehydratase large subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuC PE=3 SV=1 28 459 2.0E-39
sp|Q1AZC4|LEUC1_RUBXD 3-isopropylmalate dehydratase large subunit 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC1 PE=3 SV=1 26 457 5.0E-39
sp|B2GCB8|LEUC_LACF3 3-isopropylmalate dehydratase large subunit OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=leuC PE=3 SV=1 129 451 2.0E-38
sp|Q8EN69|LEUC_OCEIH 3-isopropylmalate dehydratase large subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuC PE=3 SV=1 26 451 2.0E-38
sp|A0AK94|LEUC_LISW6 3-isopropylmalate dehydratase large subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuC PE=3 SV=1 129 451 3.0E-38
sp|Q8U0C0|LEUC2_PYRFU 3-isopropylmalate dehydratase large subunit 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuC2 PE=3 SV=1 50 454 3.0E-38
sp|A4X4C8|LEUC_SALTO 3-isopropylmalate dehydratase large subunit OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=leuC PE=3 SV=1 129 457 4.0E-38
sp|Q6NHL0|LEUC_CORDI 3-isopropylmalate dehydratase large subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuC PE=3 SV=1 129 458 4.0E-38
sp|A4FMP2|LEUC_SACEN 3-isopropylmalate dehydratase large subunit OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuC PE=3 SV=1 129 458 5.0E-38
sp|Q94AR8|LEUC_ARATH 3-isopropylmalate dehydratase large subunit OS=Arabidopsis thaliana GN=IIL1 PE=1 SV=1 4 457 8.0E-38
sp|A8FFW3|LEUC_BACP2 3-isopropylmalate dehydratase large subunit OS=Bacillus pumilus (strain SAFR-032) GN=leuC PE=3 SV=1 28 449 8.0E-38
sp|Q1BAQ4|LEUC_MYCSS 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain MCS) GN=leuC PE=3 SV=1 27 459 1.0E-37
sp|A1UEA8|LEUC_MYCSK 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain KMS) GN=leuC PE=3 SV=1 27 459 1.0E-37
sp|A1T700|LEUC_MYCVP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuC PE=3 SV=1 28 457 1.0E-37
sp|Q4JUX2|LEUC_CORJK 3-isopropylmalate dehydratase large subunit OS=Corynebacterium jeikeium (strain K411) GN=leuC PE=3 SV=1 129 457 1.0E-37
sp|Q8Y5R7|LEUC_LISMO 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuC PE=3 SV=1 129 451 2.0E-37
sp|Q5JFV6|LEUC_THEKO 3-isopropylmalate dehydratase large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=leuC PE=3 SV=1 50 454 2.0E-37
sp|A3PXR2|LEUC_MYCSJ 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain JLS) GN=leuC PE=3 SV=1 27 459 2.0E-37
sp|Q7ZAG7|LEUC_HALVD 3-isopropylmalate dehydratase large subunit OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuC PE=3 SV=2 129 461 2.0E-37
sp|A4TE23|LEUC_MYCGI 3-isopropylmalate dehydratase large subunit OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuC PE=3 SV=1 28 457 3.0E-37
sp|A3QIN8|LEUC_SHELP 3-isopropylmalate dehydratase large subunit OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuC PE=3 SV=1 29 451 4.0E-37
sp|A0L1Q8|LEUC_SHESA 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain ANA-3) GN=leuC PE=3 SV=1 25 451 5.0E-37
sp|Q5WEN5|LEUC_BACSK 3-isopropylmalate dehydratase large subunit OS=Bacillus clausii (strain KSM-K16) GN=leuC PE=3 SV=1 29 439 6.0E-37
sp|Q0HE67|LEUC_SHESM 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-4) GN=leuC PE=3 SV=1 25 451 6.0E-37
sp|Q49Z14|LEUC_STAS1 3-isopropylmalate dehydratase large subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuC PE=3 SV=1 129 449 7.0E-37
sp|Q44427|LEUC_ACTTI 3-isopropylmalate dehydratase large subunit OS=Actinoplanes teichomyceticus GN=leuC PE=3 SV=1 129 457 8.0E-37
sp|C4LAV5|LEUC_TOLAT 3-isopropylmalate dehydratase large subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=leuC PE=3 SV=1 129 451 9.0E-37
sp|Q5V518|LEUC_HALMA 3-isopropylmalate dehydratase large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=leuC PE=3 SV=1 129 462 1.0E-36
sp|Q9ZND5|LEUC_THET8 3-isopropylmalate dehydratase large subunit OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=leuC PE=3 SV=1 29 451 1.0E-36
sp|Q72JB3|LEUC_THET2 3-isopropylmalate dehydratase large subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=leuC PE=3 SV=1 29 451 1.0E-36
sp|B7GH21|LEUC_ANOFW 3-isopropylmalate dehydratase large subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=leuC PE=3 SV=1 28 457 1.0E-36
sp|Q73B98|LEUC_BACC1 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuC PE=3 SV=1 129 451 1.0E-36
sp|B9DMJ8|LEUC_STACT 3-isopropylmalate dehydratase large subunit OS=Staphylococcus carnosus (strain TM300) GN=leuC PE=3 SV=1 129 449 1.0E-36
sp|B8DBU2|LEUC_LISMH 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuC PE=3 SV=1 129 451 1.0E-36
sp|B9IUZ2|LEUC_BACCQ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain Q1) GN=leuC PE=3 SV=1 129 451 2.0E-36
sp|B7HKC6|LEUC_BACC7 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH187) GN=leuC PE=3 SV=1 129 451 2.0E-36
sp|Q47WG2|LEUC_COLP3 3-isopropylmalate dehydratase large subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuC PE=3 SV=1 25 451 2.0E-36
sp|C1EMB1|LEUC_BACC3 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain 03BB102) GN=leuC PE=3 SV=1 129 451 2.0E-36
sp|Q81G10|LEUC_BACCR 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuC PE=3 SV=1 129 451 3.0E-36
sp|Q8F4E6|LEUC_LEPIN 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuC PE=3 SV=1 29 451 3.0E-36
sp|Q72RC4|LEUC_LEPIC 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuC PE=3 SV=1 29 451 3.0E-36
sp|B1ZKX6|LEUC_METPB 3-isopropylmalate dehydratase large subunit OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=leuC PE=3 SV=1 28 439 3.0E-36
sp|Q6GF14|LEUC_STAAR 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MRSA252) GN=leuC PE=3 SV=1 129 449 4.0E-36
sp|A8FP33|LEUC_CAMJ8 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=leuC PE=3 SV=1 129 452 4.0E-36
sp|P54384|LEUC_SYNY3 3-isopropylmalate dehydratase large subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuC PE=3 SV=2 63 451 5.0E-36
sp|A0RBL4|LEUC_BACAH 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=leuC PE=3 SV=1 129 451 5.0E-36
sp|Q8E9N4|LEUC_SHEON 3-isopropylmalate dehydratase large subunit OS=Shewanella oneidensis (strain MR-1) GN=leuC PE=3 SV=1 24 451 6.0E-36
sp|P17279|LEUC_MUCCL 3-isopropylmalate dehydratase OS=Mucor circinelloides f. lusitanicus GN=LEUA PE=3 SV=1 129 468 7.0E-36
sp|A1B513|LEUC_PARDP 3-isopropylmalate dehydratase large subunit OS=Paracoccus denitrificans (strain Pd 1222) GN=leuC PE=3 SV=1 28 462 7.0E-36
sp|C1AGA3|LEUC_MYCBT 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuC PE=3 SV=1 129 458 8.0E-36
sp|A1KMY2|LEUC_MYCBP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuC PE=3 SV=1 129 458 8.0E-36
sp|Q7TXH6|LEUC_MYCBO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuC PE=1 SV=1 129 458 8.0E-36
sp|Q92A26|LEUC_LISIN 3-isopropylmalate dehydratase large subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuC PE=3 SV=1 129 451 8.0E-36
sp|Q47SA3|LEUC_THEFY 3-isopropylmalate dehydratase large subunit OS=Thermobifida fusca (strain YX) GN=leuC PE=3 SV=1 129 457 8.0E-36
sp|A5G0G6|LEUC_ACICJ 3-isopropylmalate dehydratase large subunit OS=Acidiphilium cryptum (strain JF-5) GN=leuC PE=3 SV=1 30 457 9.0E-36
sp|O33123|LEUC_MYCLE 3-isopropylmalate dehydratase large subunit OS=Mycobacterium leprae (strain TN) GN=leuC PE=3 SV=1 25 458 9.0E-36
sp|Q71Y33|LEUC_LISMF 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuC PE=3 SV=1 129 451 1.0E-35
sp|C1KWT3|LEUC_LISMC 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuC PE=3 SV=1 129 451 1.0E-35
sp|B7HHF7|LEUC_BACC4 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain B4264) GN=leuC PE=3 SV=1 129 451 1.0E-35
sp|Q4L7U2|LEUC_STAHJ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuC PE=3 SV=1 129 449 1.0E-35
sp|Q2JPG2|LEUC_SYNJB 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuC PE=3 SV=1 129 457 1.0E-35
sp|P9WQF5|LEUC_MYCTU 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuC PE=1 SV=1 129 458 2.0E-35
sp|P9WQF4|LEUC_MYCTO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuC PE=3 SV=1 129 458 2.0E-35
sp|A5U6Z9|LEUC_MYCTA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuC PE=3 SV=1 129 458 2.0E-35
sp|A8Z4W2|LEUC_STAAT 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|P63436|LEUC_STAAN 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain N315) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|P63435|LEUC_STAAM 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|A6QIQ5|LEUC_STAAE 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Newman) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|Q5HEE2|LEUC_STAAC 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain COL) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|Q2YUF0|LEUC_STAAB 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|A5IUK5|LEUC_STAA9 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain JH9) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|Q2FWK1|LEUC_STAA8 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain NCTC 8325) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|Q2FF65|LEUC_STAA3 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain USA300) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|A6U3E4|LEUC_STAA2 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain JH1) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|A7X4N3|LEUC_STAA1 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=leuC PE=3 SV=1 129 449 2.0E-35
sp|Q5FUG3|LEUC_GLUOX 3-isopropylmalate dehydratase large subunit OS=Gluconobacter oxydans (strain 621H) GN=leuC PE=3 SV=1 25 462 2.0E-35
sp|Q67MJ2|LEUC_SYMTH 3-isopropylmalate dehydratase large subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuC PE=3 SV=1 29 451 2.0E-35
sp|Q8CNL1|LEUC_STAES 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuC PE=3 SV=1 29 449 2.0E-35
sp|B1MDQ1|LEUC_MYCA9 3-isopropylmalate dehydratase large subunit OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=leuC PE=3 SV=1 28 460 2.0E-35
sp|A6W7Q7|LEUC_KINRD 3-isopropylmalate dehydratase large subunit OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=leuC PE=3 SV=1 129 458 2.0E-35
sp|Q81T66|LEUC_BACAN 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis GN=leuC PE=3 SV=1 129 451 2.0E-35
sp|C3L9Q5|LEUC_BACAC 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=leuC PE=3 SV=1 129 451 2.0E-35
sp|C3P4Z8|LEUC_BACAA 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain A0248) GN=leuC PE=3 SV=1 129 451 2.0E-35
sp|B7JFY7|LEUC_BACC0 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH820) GN=leuC PE=3 SV=1 129 451 2.0E-35
sp|B8HAC9|LEUC_ARTCA 3-isopropylmalate dehydratase large subunit OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=leuC PE=3 SV=1 129 458 3.0E-35
sp|Q6HLF1|LEUC_BACHK 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuC PE=3 SV=1 129 451 3.0E-35
sp|B1WZV3|LEUC_CYAA5 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain ATCC 51142) GN=leuC PE=3 SV=1 129 451 3.0E-35
sp|C1F700|LEUC_ACIC5 3-isopropylmalate dehydratase large subunit OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=leuC PE=3 SV=1 29 451 3.0E-35
sp|P58947|LEUC_STAAW 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MW2) GN=leuC PE=3 SV=1 129 449 3.0E-35
sp|Q6G7P9|LEUC_STAAS 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MSSA476) GN=leuC PE=3 SV=1 129 449 3.0E-35
sp|Q8UBY9|LEUC_AGRFC 3-isopropylmalate dehydratase large subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuC PE=3 SV=2 28 451 3.0E-35
sp|Q63DX6|LEUC_BACCZ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ZK / E33L) GN=leuC PE=3 SV=1 129 451 4.0E-35
sp|B1LXK9|LEUC_METRJ 3-isopropylmalate dehydratase large subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=leuC PE=3 SV=1 27 439 4.0E-35
sp|A9VLG9|LEUC_BACWK 3-isopropylmalate dehydratase large subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=leuC PE=3 SV=1 129 451 5.0E-35
sp|B7IN95|LEUC_BACC2 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain G9842) GN=leuC PE=3 SV=1 129 451 5.0E-35
sp|B0JY97|LEUC_MICAN 3-isopropylmalate dehydratase large subunit OS=Microcystis aeruginosa (strain NIES-843) GN=leuC PE=3 SV=1 27 457 6.0E-35
sp|Q2RV55|LEUC_RHORT 3-isopropylmalate dehydratase large subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuC PE=3 SV=1 28 460 6.0E-35
sp|B9LUZ3|LEUC_HALLT 3-isopropylmalate dehydratase large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=leuC PE=3 SV=1 129 451 7.0E-35
sp|A1W1X0|LEUC_CAMJJ 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=leuC PE=3 SV=1 129 452 7.0E-35
sp|A7H665|LEUC_CAMJD 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuC PE=3 SV=1 129 452 8.0E-35
sp|B2J3M9|LEUC_NOSP7 3-isopropylmalate dehydratase large subunit OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=leuC PE=3 SV=1 129 451 9.0E-35
sp|Q5HS78|LEUC_CAMJR 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni (strain RM1221) GN=leuC PE=3 SV=1 129 452 1.0E-34
sp|Q73VI7|LEUC_MYCPA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuC PE=3 SV=1 27 458 1.0E-34
sp|Q9PLW1|LEUC_CAMJE 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuC PE=3 SV=1 129 452 1.0E-34
sp|A7GMU3|LEUC_BACCN 3-isopropylmalate dehydratase large subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuC PE=3 SV=1 129 451 1.0E-34
sp|B7GNM7|LEUC_BIFLS 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuC PE=3 SV=1 129 457 1.0E-34
sp|Q0HZT2|LEUC_SHESR 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-7) GN=leuC PE=3 SV=1 31 451 1.0E-34
sp|A0QJB7|LEUC_MYCA1 3-isopropylmalate dehydratase large subunit OS=Mycobacterium avium (strain 104) GN=leuC PE=3 SV=1 27 458 1.0E-34
sp|B7KH96|LEUC_CYAP7 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7424) GN=leuC PE=3 SV=1 82 451 1.0E-34
sp|P44968|LEUC_HAEIN 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuC PE=3 SV=2 129 449 1.0E-34
sp|Q2JQU3|LEUC_SYNJA 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuC PE=3 SV=1 129 451 1.0E-34
sp|A8L567|LEUC_FRASN 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain EAN1pec) GN=leuC PE=3 SV=1 29 457 1.0E-34
sp|A6T015|LEUC_JANMA 3-isopropylmalate dehydratase large subunit OS=Janthinobacterium sp. (strain Marseille) GN=leuC PE=3 SV=1 29 457 2.0E-34
sp|B8GQD6|LEUC_THISH 3-isopropylmalate dehydratase large subunit OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=leuC PE=3 SV=1 129 460 2.0E-34
sp|C3M9V0|LEUC_RHISN 3-isopropylmalate dehydratase large subunit OS=Rhizobium sp. (strain NGR234) GN=leuC PE=3 SV=1 28 451 2.0E-34
sp|A0JXX8|LEUC_ARTS2 3-isopropylmalate dehydratase large subunit OS=Arthrobacter sp. (strain FB24) GN=leuC PE=3 SV=1 129 458 3.0E-34
sp|Q8TW29|LEUC2_METKA 3-isopropylmalate dehydratase large subunit 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC2 PE=3 SV=1 46 457 3.0E-34
sp|Q0AT09|LEUC_MARMM 3-isopropylmalate dehydratase large subunit OS=Maricaulis maris (strain MCS10) GN=leuC PE=3 SV=1 129 457 3.0E-34
sp|Q6AFK7|LEUC_LEIXX 3-isopropylmalate dehydratase large subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuC PE=3 SV=1 28 458 3.0E-34
sp|Q07WH1|LEUC_SHEFN 3-isopropylmalate dehydratase large subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=leuC PE=3 SV=1 27 451 3.0E-34
sp|A4Y2M2|LEUC_SHEPC 3-isopropylmalate dehydratase large subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuC PE=3 SV=1 24 451 3.0E-34
sp|Q7VDT0|LEUC_PROMA 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuC PE=3 SV=1 63 451 3.0E-34
sp|B2HII1|LEUC_MYCMM 3-isopropylmalate dehydratase large subunit OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuC PE=3 SV=1 129 458 3.0E-34
sp|Q65V07|LEUC2_MANSM 3-isopropylmalate dehydratase large subunit 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC2 PE=3 SV=1 129 449 4.0E-34
sp|A8H999|LEUC_SHEPA 3-isopropylmalate dehydratase large subunit OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=leuC PE=3 SV=1 29 451 4.0E-34
sp|A1JJH5|LEUC_YERE8 3-isopropylmalate dehydratase large subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuC PE=3 SV=1 129 461 4.0E-34
sp|Q03UM2|LEUC_LEUMM 3-isopropylmalate dehydratase large subunit OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=leuC PE=3 SV=1 129 451 5.0E-34
sp|A1R7K0|LEUC_ARTAT 3-isopropylmalate dehydratase large subunit OS=Arthrobacter aurescens (strain TC1) GN=leuC PE=3 SV=1 129 458 5.0E-34
sp|A2RKR3|LEUC_LACLM 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=leuC PE=3 SV=1 29 449 6.0E-34
sp|Q3M614|LEUC_ANAVT 3-isopropylmalate dehydratase large subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuC PE=3 SV=1 30 451 6.0E-34
sp|Q8YX02|LEUC_NOSS1 3-isopropylmalate dehydratase large subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuC PE=3 SV=1 30 451 6.0E-34
sp|A4G4F5|LEUC_HERAR 3-isopropylmalate dehydratase large subunit OS=Herminiimonas arsenicoxydans GN=leuC PE=3 SV=1 29 457 7.0E-34
sp|A6VQL0|LEUC_ACTSZ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=leuC PE=3 SV=1 129 449 7.0E-34
sp|A7MWC3|LEUC_VIBCB 3-isopropylmalate dehydratase large subunit OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=leuC PE=3 SV=1 129 458 8.0E-34
sp|Q0RDK7|LEUC_FRAAA 3-isopropylmalate dehydratase large subunit OS=Frankia alni (strain ACN14a) GN=leuC PE=3 SV=1 129 457 1.0E-33
sp|B7K213|LEUC_CYAP8 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 8801) GN=leuC PE=3 SV=1 129 451 1.0E-33
sp|Q2J6W9|LEUC_FRASC 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain CcI3) GN=leuC PE=3 SV=1 129 457 1.0E-33
sp|A0PPZ6|LEUC_MYCUA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium ulcerans (strain Agy99) GN=leuC PE=3 SV=1 129 458 1.0E-33
sp|Q8Z9I2|LEUC_SALTI 3-isopropylmalate dehydratase large subunit OS=Salmonella typhi GN=leuC PE=3 SV=2 129 457 1.0E-33
sp|B4TWV9|LEUC_SALSV 3-isopropylmalate dehydratase large subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=leuC PE=3 SV=1 129 457 1.0E-33
sp|B5F7U7|LEUC_SALA4 3-isopropylmalate dehydratase large subunit OS=Salmonella agona (strain SL483) GN=leuC PE=3 SV=1 129 457 1.0E-33
sp|Q57TE8|LEUC1_SALCH 3-isopropylmalate dehydratase large subunit 1 OS=Salmonella choleraesuis (strain SC-B67) GN=leuC1 PE=3 SV=1 129 457 1.0E-33
sp|P15717|LEUC1_SALTY 3-isopropylmalate dehydratase large subunit 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuC1 PE=1 SV=4 129 457 2.0E-33
sp|A3PAX7|LEUC_PROM0 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9301) GN=leuC PE=3 SV=1 63 451 2.0E-33
sp|B1XLQ6|LEUC_SYNP2 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuC PE=3 SV=1 129 458 2.0E-33
sp|A1REY2|LEUC_SHESW 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain W3-18-1) GN=leuC PE=3 SV=1 24 451 2.0E-33
sp|B8F3W8|LEUC_HAEPS 3-isopropylmalate dehydratase large subunit OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=leuC PE=3 SV=1 29 449 2.0E-33
sp|Q92L76|LEUC_RHIME 3-isopropylmalate dehydratase large subunit OS=Rhizobium meliloti (strain 1021) GN=leuC PE=3 SV=1 28 451 2.0E-33
sp|B8CM41|LEUC_SHEPW 3-isopropylmalate dehydratase large subunit OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=leuC PE=3 SV=1 29 451 2.0E-33
sp|B8HLN1|LEUC_CYAP4 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuC PE=3 SV=1 30 451 3.0E-33
sp|B1KKZ2|LEUC_SHEWM 3-isopropylmalate dehydratase large subunit OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=leuC PE=3 SV=1 29 451 3.0E-33
sp|Q5HMF7|LEUC_STAEQ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuC PE=3 SV=1 29 449 4.0E-33
sp|A1S2E2|LEUC_SHEAM 3-isopropylmalate dehydratase large subunit OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=leuC PE=3 SV=1 129 451 4.0E-33
sp|A6UE05|LEUC_SINMW 3-isopropylmalate dehydratase large subunit OS=Sinorhizobium medicae (strain WSM419) GN=leuC PE=3 SV=1 63 451 4.0E-33
sp|Q65VS0|LEUC1_MANSM 3-isopropylmalate dehydratase large subunit 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC1 PE=3 SV=1 129 451 4.0E-33
sp|Q2S0M6|LEUC_SALRD 3-isopropylmalate dehydratase large subunit OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuC PE=3 SV=1 129 451 4.0E-33
sp|A9KY15|LEUC_SHEB9 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS195) GN=leuC PE=3 SV=1 29 451 5.0E-33
sp|A6WIB7|LEUC_SHEB8 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS185) GN=leuC PE=3 SV=1 29 451 5.0E-33
sp|B9JUD6|LEUC_AGRVS 3-isopropylmalate dehydratase large subunit OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=leuC PE=3 SV=1 28 451 5.0E-33
sp|A9MQE0|LEUC_SALAR 3-isopropylmalate dehydratase large subunit OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=leuC PE=3 SV=1 129 449 5.0E-33
sp|Q7UIA7|LEUC_RHOBA 3-isopropylmalate dehydratase large subunit OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=leuC PE=3 SV=2 29 451 6.0E-33
sp|B0TQM2|LEUC_SHEHH 3-isopropylmalate dehydratase large subunit OS=Shewanella halifaxensis (strain HAW-EB4) GN=leuC PE=3 SV=1 29 451 6.0E-33
sp|B5BLB3|LEUC_SALPK 3-isopropylmalate dehydratase large subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=leuC PE=3 SV=1 129 457 8.0E-33
sp|Q5PDG3|LEUC_SALPA 3-isopropylmalate dehydratase large subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuC PE=3 SV=1 129 457 8.0E-33
sp|A3CZK7|LEUC_SHEB5 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuC PE=3 SV=1 29 451 9.0E-33
sp|Q1GDM6|LEUC_RUEST 3-isopropylmalate dehydratase large subunit OS=Ruegeria sp. (strain TM1040) GN=leuC PE=3 SV=1 27 451 1.0E-32
sp|O85072|LEUC_BUCDN 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuC PE=3 SV=1 129 458 1.0E-32
sp|B4F196|LEUC_PROMH 3-isopropylmalate dehydratase large subunit OS=Proteus mirabilis (strain HI4320) GN=leuC PE=3 SV=1 129 451 1.0E-32
sp|Q2VZV4|LEUC_MAGSA 3-isopropylmalate dehydratase large subunit OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuC PE=3 SV=1 56 457 1.0E-32
sp|B8E4K6|LEUC_SHEB2 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS223) GN=leuC PE=3 SV=1 29 451 1.0E-32
sp|B0USF4|LEUC_HISS2 3-isopropylmalate dehydratase large subunit OS=Histophilus somni (strain 2336) GN=leuC PE=3 SV=1 129 449 1.0E-32
sp|Q0I2G3|LEUC_HAES1 3-isopropylmalate dehydratase large subunit OS=Haemophilus somnus (strain 129Pt) GN=leuC PE=3 SV=1 129 449 1.0E-32
sp|O86534|LEUC_STRCO 3-isopropylmalate dehydratase large subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuC PE=3 SV=1 129 463 1.0E-32
sp|Q9V1J0|LEUC2_PYRAB 3-isopropylmalate dehydratase large subunit 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuC2 PE=3 SV=1 50 454 2.0E-32
sp|A1U0Y0|LEUC_MARHV 3-isopropylmalate dehydratase large subunit OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=leuC PE=3 SV=1 129 451 2.0E-32
sp|B3GZY1|LEUC_ACTP7 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=leuC PE=3 SV=1 129 439 2.0E-32
sp|Q32K22|LEUC_SHIDS 3-isopropylmalate dehydratase large subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuC PE=3 SV=1 129 451 2.0E-32
sp|B2UPW8|LEUC_AKKM8 3-isopropylmalate dehydratase large subunit OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=leuC PE=3 SV=1 29 451 2.0E-32
sp|A1SLW5|LEUC_NOCSJ 3-isopropylmalate dehydratase large subunit OS=Nocardioides sp. (strain BAA-499 / JS614) GN=leuC PE=3 SV=1 129 458 2.0E-32
sp|Q606F2|LEUC_METCA 3-isopropylmalate dehydratase large subunit OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuC PE=3 SV=1 129 451 2.0E-32
sp|P19414|ACON_YEAST Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO1 PE=1 SV=2 24 615 3.0E-32
sp|A3MYL1|LEUC_ACTP2 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=leuC PE=3 SV=1 129 439 3.0E-32
sp|Q3SHL1|LEUC_THIDA 3-isopropylmalate dehydratase large subunit OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuC PE=3 SV=1 129 451 3.0E-32
sp|B1JKA0|LEUC_YERPY 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|A4TQA4|LEUC_YERPP 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis (strain Pestoides F) GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|Q1CMP7|LEUC_YERPN 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|A9R144|LEUC_YERPG 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|Q8ZIH0|LEUC_YERPE 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|Q1C1Z4|LEUC_YERPA 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|A7FM86|LEUC_YERP3 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|Q0IDD5|LEUC_SYNS3 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain CC9311) GN=leuC PE=3 SV=1 129 457 3.0E-32
sp|Q66EM3|LEUC_YERPS 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|B2K4C7|LEUC_YERPB 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuC PE=3 SV=1 129 461 3.0E-32
sp|Q02142|LEUC_LACLA 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=leuC PE=3 SV=2 129 439 4.0E-32
sp|B0BS44|LEUC_ACTPJ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=leuC PE=3 SV=1 129 439 4.0E-32
sp|Q7V4U5|LEUC_PROMM 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9313) GN=leuC PE=3 SV=1 129 463 4.0E-32
sp|B7LWE0|LEUC_ESCF3 3-isopropylmalate dehydratase large subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuC PE=3 SV=1 129 451 4.0E-32
sp|B1ZUZ1|LEUC_OPITP 3-isopropylmalate dehydratase large subunit OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=leuC PE=3 SV=1 129 451 4.0E-32
sp|B7N7U7|LEUC_ECOLU 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuC PE=3 SV=1 129 451 4.0E-32
sp|A7MIC7|LEUC_CROS8 3-isopropylmalate dehydratase large subunit OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuC PE=3 SV=1 129 457 4.0E-32
sp|B1IRA6|LEUC_ECOLC 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuC PE=3 SV=1 129 451 5.0E-32
sp|A7ZW23|LEUC_ECOHS 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O9:H4 (strain HS) GN=leuC PE=3 SV=1 129 451 5.0E-32
sp|B0CG35|LEUC_ACAM1 3-isopropylmalate dehydratase large subunit OS=Acaryochloris marina (strain MBIC 11017) GN=leuC PE=3 SV=1 63 451 5.0E-32
sp|Q87SS9|LEUC_VIBPA 3-isopropylmalate dehydratase large subunit OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuC PE=3 SV=1 129 451 5.0E-32
sp|Q4WLN1|ACON_ASPFU Aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoA PE=1 SV=1 24 615 5.0E-32
sp|Q3Z5T8|LEUC_SHISS 3-isopropylmalate dehydratase large subunit OS=Shigella sonnei (strain Ss046) GN=leuC PE=3 SV=1 129 451 5.0E-32
sp|A9GL99|LEUC_SORC5 3-isopropylmalate dehydratase large subunit OS=Sorangium cellulosum (strain So ce56) GN=leuC PE=3 SV=1 129 451 6.0E-32
sp|A6WXG4|LEUC_OCHA4 3-isopropylmalate dehydratase large subunit OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=leuC PE=3 SV=1 28 451 6.0E-32
sp|A5UD83|LEUC_HAEIE 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain PittEE) GN=leuC PE=3 SV=1 129 439 6.0E-32
sp|B7UIC2|LEUC_ECO27 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuC PE=3 SV=1 129 451 6.0E-32
sp|B7L4J3|LEUC_ECO55 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain 55989 / EAEC) GN=leuC PE=3 SV=1 129 451 6.0E-32
sp|Q0T8C6|LEUC_SHIF8 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=leuC PE=3 SV=1 129 451 6.0E-32
sp|A0ZZS7|LEUC_BIFAA 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=leuC PE=3 SV=1 129 457 7.0E-32
sp|Q326G3|LEUC_SHIBS 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|B2U279|LEUC_SHIB3 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|Q1RGC5|LEUC_ECOUT 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|B1LG09|LEUC_ECOSM 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|B6HZ52|LEUC_ECOSE 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SE11) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|P0A6A6|LEUC_ECOLI 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12) GN=leuC PE=1 SV=2 129 451 7.0E-32
sp|P0A6A7|LEUC_ECOL6 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuC PE=3 SV=2 129 451 7.0E-32
sp|Q0TLR7|LEUC_ECOL5 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|A1A7C0|LEUC_ECOK1 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O1:K1 / APEC GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|C4ZPZ5|LEUC_ECOBW 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|B7M117|LEUC_ECO8A 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O8 (strain IAI1) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|B7MNT0|LEUC_ECO81 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O81 (strain ED1a) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|B7NHI0|LEUC_ECO7I 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|B7MAJ7|LEUC_ECO45 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuC PE=3 SV=1 129 451 7.0E-32
sp|Q0VPI0|LEUC_ALCBS 3-isopropylmalate dehydratase large subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuC PE=3 SV=2 129 460 7.0E-32
sp|Q0A9B0|LEUC_ALKEH 3-isopropylmalate dehydratase large subunit OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=leuC PE=3 SV=1 129 451 8.0E-32
sp|A8G2R6|LEUC_PROM2 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9215) GN=leuC PE=3 SV=1 82 451 8.0E-32
sp|A7ZHG4|LEUC_ECO24 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuC PE=3 SV=1 129 451 1.0E-31
sp|B7KRK4|LEUC_METC4 3-isopropylmalate dehydratase large subunit OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=leuC PE=3 SV=1 28 439 1.0E-31
sp|A4W6H7|LEUC_ENT38 3-isopropylmalate dehydratase large subunit OS=Enterobacter sp. (strain 638) GN=leuC PE=3 SV=1 129 451 1.0E-31
sp|Q8FYG9|LEUC_BRUSU 3-isopropylmalate dehydratase large subunit OS=Brucella suis biovar 1 (strain 1330) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|B0CIF7|LEUC_BRUSI 3-isopropylmalate dehydratase large subunit OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|A5VSN3|LEUC_BRUO2 3-isopropylmalate dehydratase large subunit OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|A9M8P2|LEUC_BRUC2 3-isopropylmalate dehydratase large subunit OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|Q57AZ0|LEUC_BRUAB 3-isopropylmalate dehydratase large subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|Q2YLP7|LEUC_BRUA2 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain 2308) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|B2S860|LEUC_BRUA1 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain S19) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|Q0BRH4|LEUC_GRABC 3-isopropylmalate dehydratase large subunit OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=leuC PE=3 SV=1 129 458 1.0E-31
sp|B5YZA8|LEUC_ECO5E 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuC PE=3 SV=1 129 451 1.0E-31
sp|Q8XA00|LEUC_ECO57 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 GN=leuC PE=3 SV=3 129 451 1.0E-31
sp|Q8YJC9|LEUC_BRUME 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|C0RFF1|LEUC_BRUMB 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=leuC PE=3 SV=1 28 451 1.0E-31
sp|Q4QLS2|LEUC_HAEI8 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain 86-028NP) GN=leuC PE=3 SV=1 129 439 2.0E-31
sp|A6T4L7|LEUC_KLEP7 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuC PE=3 SV=1 129 451 2.0E-31
sp|Q3IRQ4|LEUC_NATPD 3-isopropylmalate dehydratase large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=leuC PE=3 SV=1 129 451 2.0E-31
sp|A2BUN7|LEUC_PROM5 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9515) GN=leuC PE=3 SV=1 82 451 2.0E-31
sp|A2CCJ0|LEUC_PROM3 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9303) GN=leuC PE=3 SV=1 129 463 2.0E-31
sp|Q82JR8|LEUC_STRAW 3-isopropylmalate dehydratase large subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=leuC PE=3 SV=1 129 457 2.0E-31
sp|P39533|ACON2_YEAST Homocitrate dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO2 PE=1 SV=1 28 463 2.0E-31
sp|Q7VQJ8|LEUC_BLOFL 3-isopropylmalate dehydratase large subunit OS=Blochmannia floridanus GN=leuC PE=3 SV=1 129 451 3.0E-31
sp|Q46HB8|LEUC_PROMT 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL2A) GN=leuC PE=3 SV=1 129 451 3.0E-31
sp|A5WGT5|LEUC_PSYWF 3-isopropylmalate dehydratase large subunit OS=Psychrobacter sp. (strain PRwf-1) GN=leuC PE=3 SV=1 129 451 3.0E-31
sp|B9JCN5|LEUC_AGRRK 3-isopropylmalate dehydratase large subunit OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=leuC PE=3 SV=1 28 451 3.0E-31
sp|Q6FEW0|LEUC_ACIAD 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuC PE=3 SV=1 129 451 3.0E-31
sp|A6VX34|LEUC_MARMS 3-isopropylmalate dehydratase large subunit OS=Marinomonas sp. (strain MWYL1) GN=leuC PE=3 SV=1 129 451 4.0E-31
sp|A5CX27|LEUC_VESOH 3-isopropylmalate dehydratase large subunit OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=leuC PE=3 SV=1 123 451 4.0E-31
sp|B5Y1W4|LEUC_KLEP3 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae (strain 342) GN=leuC PE=3 SV=1 129 451 4.0E-31
sp|Q821C2|LEUC_SHIFL 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri GN=leuC PE=3 SV=1 129 451 4.0E-31
sp|D4AT77|ACON_ARTBC Aconitate hydratase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07441 PE=1 SV=1 24 615 4.0E-31
sp|B4RVU9|LEUC_ALTMD 3-isopropylmalate dehydratase large subunit OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=leuC PE=3 SV=1 29 449 5.0E-31
sp|Q9CJN7|LEUC_PASMU 3-isopropylmalate dehydratase large subunit OS=Pasteurella multocida (strain Pm70) GN=leuC PE=3 SV=3 52 458 5.0E-31
sp|Q5MZY3|LEUC_SYNP6 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuC PE=3 SV=1 129 439 5.0E-31
sp|Q31LZ1|LEUC_SYNE7 3-isopropylmalate dehydratase large subunit OS=Synechococcus elongatus (strain PCC 7942) GN=leuC PE=3 SV=1 129 439 5.0E-31
sp|Q6D0G6|LEUC_PECAS 3-isopropylmalate dehydratase large subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuC PE=3 SV=1 63 449 6.0E-31
sp|Q5E858|LEUC_VIBF1 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuC PE=3 SV=1 129 451 7.0E-31
sp|B1VZ03|LEUC_STRGG 3-isopropylmalate dehydratase large subunit OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuC PE=3 SV=1 129 463 7.0E-31
sp|Q493R2|LEUC_BLOPB 3-isopropylmalate dehydratase large subunit OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuC PE=3 SV=1 129 439 8.0E-31
sp|Q02YY1|LEUC_LACLS 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=leuC PE=3 SV=1 27 439 8.0E-31
sp|Q7N127|LEUC_PHOLL 3-isopropylmalate dehydratase large subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuC PE=3 SV=1 63 451 9.0E-31
sp|A8FQ85|LEUC_SHESH 3-isopropylmalate dehydratase large subunit OS=Shewanella sediminis (strain HAW-EB3) GN=leuC PE=3 SV=1 29 451 9.0E-31
sp|Q6LV26|LEUC_PHOPR 3-isopropylmalate dehydratase large subunit OS=Photobacterium profundum GN=leuC PE=3 SV=2 129 461 9.0E-31
sp|B9KMK4|LEUC_RHOSK 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=leuC PE=3 SV=1 28 464 9.0E-31
sp|A4SWW8|LEUC_POLSQ 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuC PE=3 SV=1 129 451 1.0E-30
sp|Q3IZI8|LEUC_RHOS4 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuC PE=3 SV=1 28 451 1.0E-30
sp|A2C088|LEUC_PROM1 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL1A) GN=leuC PE=3 SV=1 129 451 1.0E-30
sp|Q5LZF4|LEUC_STRT1 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain CNRZ 1066) GN=leuC PE=3 SV=2 129 466 1.0E-30
sp|A3PMQ9|LEUC_RHOS1 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=leuC PE=3 SV=1 28 451 1.0E-30
sp|A7HBI2|LEUC_ANADF 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain Fw109-5) GN=leuC PE=3 SV=1 26 428 1.0E-30
sp|Q11NN8|LEUC_CYTH3 3-isopropylmalate dehydratase large subunit OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=leuC PE=3 SV=1 129 451 1.0E-30
sp|A1AW36|LEUC_RUTMC 3-isopropylmalate dehydratase large subunit OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuC PE=3 SV=2 129 429 1.0E-30
sp|A5GIG7|LEUC_SYNPW 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain WH7803) GN=leuC PE=3 SV=1 129 451 1.0E-30
sp|B1XV55|LEUC_POLNS 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=leuC PE=3 SV=1 129 451 1.0E-30
sp|Q7V336|LEUC_PROMP 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuC PE=3 SV=1 82 451 1.0E-30
sp|B5FGH2|LEUC_VIBFM 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain MJ11) GN=leuC PE=3 SV=1 129 451 2.0E-30
sp|Q3AN00|LEUC_SYNSC 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain CC9605) GN=leuC PE=3 SV=1 129 451 2.0E-30
sp|Q5M406|LEUC_STRT2 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=leuC PE=3 SV=2 129 466 2.0E-30
sp|A4WNV5|LEUC_RHOS5 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=leuC PE=3 SV=1 28 462 2.0E-30
sp|Q03KB3|LEUC_STRTD 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=leuC PE=3 SV=1 129 466 2.0E-30
sp|P56934|LEUC_BUCAI 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuC PE=3 SV=2 129 449 2.0E-30
sp|B5ZTI5|LEUC_RHILW 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=leuC PE=3 SV=1 28 451 2.0E-30
sp|A8G9Q9|LEUC_SERP5 3-isopropylmalate dehydratase large subunit OS=Serratia proteamaculans (strain 568) GN=leuC PE=3 SV=1 129 439 2.0E-30
sp|C6DEW0|LEUC_PECCP 3-isopropylmalate dehydratase large subunit OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuC PE=3 SV=1 63 449 2.0E-30
sp|Q8DKF0|LEUC_THEEB 3-isopropylmalate dehydratase large subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=leuC PE=3 SV=1 30 439 3.0E-30
sp|A6V2V3|LEUC_PSEA7 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain PA7) GN=leuC PE=3 SV=1 129 449 3.0E-30
sp|A3M1S8|LEUC_ACIBT 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=leuC PE=3 SV=2 129 451 3.0E-30
sp|Q1ICW0|LEUC_PSEE4 3-isopropylmalate dehydratase large subunit OS=Pseudomonas entomophila (strain L48) GN=leuC PE=3 SV=1 129 451 4.0E-30
sp|A1TLH6|LEUC_ACIAC 3-isopropylmalate dehydratase large subunit OS=Acidovorax citrulli (strain AAC00-1) GN=leuC PE=3 SV=1 129 451 4.0E-30
sp|Q47HR4|LEUC_DECAR 3-isopropylmalate dehydratase large subunit OS=Dechloromonas aromatica (strain RCB) GN=leuC PE=3 SV=1 129 439 4.0E-30
sp|O31293|LEUC_BUCTS 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuC PE=3 SV=1 63 450 4.0E-30
sp|B6ELJ8|LEUC_ALISL 3-isopropylmalate dehydratase large subunit OS=Aliivibrio salmonicida (strain LFI1238) GN=leuC PE=3 SV=1 129 451 4.0E-30
sp|Q3SNV3|LEUC_NITWN 3-isopropylmalate dehydratase large subunit OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuC PE=3 SV=1 28 451 4.0E-30
sp|Q9HZA3|LEUC_PSEAE 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=leuC PE=3 SV=1 129 449 4.0E-30
sp|Q02PT4|LEUC_PSEAB 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=leuC PE=3 SV=1 129 449 4.0E-30
sp|B7VBP9|LEUC_PSEA8 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain LESB58) GN=leuC PE=3 SV=1 129 449 4.0E-30
sp|A8ALM7|LEUC_CITK8 3-isopropylmalate dehydratase large subunit OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=leuC PE=3 SV=1 129 457 4.0E-30
sp|Q1MAJ9|LEUC_RHIL3 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuC PE=3 SV=1 63 451 4.0E-30
sp|B1HR96|LEUC_LYSSC 3-isopropylmalate dehydratase large subunit OS=Lysinibacillus sphaericus (strain C3-41) GN=leuC PE=3 SV=1 29 451 5.0E-30
sp|P82611|ACON_CANAL Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACO1 PE=1 SV=2 20 449 5.0E-30
sp|B7H0T7|LEUC_ACIB3 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB307-0294) GN=leuC PE=3 SV=1 129 451 5.0E-30
sp|B7I4E1|LEUC_ACIB5 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB0057) GN=leuC PE=3 SV=1 129 451 5.0E-30
sp|Q13DU7|LEUC_RHOPS 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain BisB5) GN=leuC PE=3 SV=1 28 451 6.0E-30
sp|B2I359|LEUC_ACIBC 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ACICU) GN=leuC PE=3 SV=1 129 451 6.0E-30
sp|B9MDK8|LEUC_ACIET 3-isopropylmalate dehydratase large subunit OS=Acidovorax ebreus (strain TPSY) GN=leuC PE=3 SV=1 129 451 8.0E-30
sp|Q28W60|LEUC_JANSC 3-isopropylmalate dehydratase large subunit OS=Jannaschia sp. (strain CCS1) GN=leuC PE=3 SV=1 63 451 8.0E-30
sp|A7HT10|LEUC_PARL1 3-isopropylmalate dehydratase large subunit OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuC PE=3 SV=1 28 451 9.0E-30
sp|Q3IJS4|LEUC_PSEHT 3-isopropylmalate dehydratase large subunit OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuC PE=3 SV=1 129 451 9.0E-30
sp|Q8DTG4|LEUC_STRMU 3-isopropylmalate dehydratase large subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=leuC PE=3 SV=1 129 466 9.0E-30
sp|Q89X98|LEUC1_BRADU 3-isopropylmalate dehydratase large subunit 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC1 PE=3 SV=2 129 436 1.0E-29
sp|A1WAS7|LEUC_ACISJ 3-isopropylmalate dehydratase large subunit OS=Acidovorax sp. (strain JS42) GN=leuC PE=3 SV=1 129 451 1.0E-29
sp|Q2J3A1|LEUC_RHOP2 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain HaA2) GN=leuC PE=3 SV=1 28 451 1.0E-29
sp|B6JAQ9|LEUC_OLICO 3-isopropylmalate dehydratase large subunit OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=leuC PE=3 SV=1 28 451 1.0E-29
sp|B5ENJ1|LEUC_ACIF5 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=leuC PE=3 SV=1 129 451 1.0E-29
sp|B7J5E0|LEUC_ACIF2 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=leuC PE=3 SV=1 129 451 1.0E-29
sp|Q3J716|LEUC_NITOC 3-isopropylmalate dehydratase large subunit OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=leuC PE=3 SV=1 129 458 2.0E-29
sp|A9BDM7|LEUC_PROM4 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9211) GN=leuC PE=3 SV=1 129 451 2.0E-29
sp|Q9EVI6|LEUC_BUCUN 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuC PE=3 SV=1 129 428 3.0E-29
sp|Q82WI9|LEUC_NITEU 3-isopropylmalate dehydratase large subunit OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|A0KGM7|LEUC_AERHH 3-isopropylmalate dehydratase large subunit OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=leuC PE=3 SV=1 129 449 3.0E-29
sp|A1UZ32|LEUC_BURMS 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain SAVP1) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|Q62AI6|LEUC_BURMA 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain ATCC 23344) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|A2S127|LEUC_BURM9 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10229) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|A3MBT5|LEUC_BURM7 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10247) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|Q1IMI3|LEUC_KORVE 3-isopropylmalate dehydratase large subunit OS=Koribacter versatilis (strain Ellin345) GN=leuC PE=3 SV=1 28 451 3.0E-29
sp|A1VRR0|LEUC_POLNA 3-isopropylmalate dehydratase large subunit OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|Q63JK9|LEUC_BURPS 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain K96243) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|A3NM77|LEUC_BURP6 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 668) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|Q3JKG6|LEUC_BURP1 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1710b) GN=leuC PE=3 SV=2 129 451 3.0E-29
sp|A3P7N9|LEUC_BURP0 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1106a) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|B1MVR0|LEUC_LEUCK 3-isopropylmalate dehydratase large subunit OS=Leuconostoc citreum (strain KM20) GN=leuC PE=3 SV=1 129 451 3.0E-29
sp|A1K4A1|LEUC_AZOSB 3-isopropylmalate dehydratase large subunit OS=Azoarcus sp. (strain BH72) GN=leuC PE=3 SV=1 129 458 4.0E-29
sp|C8VG90|ACON_EMENI Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoA PE=2 SV=1 24 615 4.0E-29
sp|Q1H0L4|LEUC_METFK 3-isopropylmalate dehydratase large subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=leuC PE=3 SV=1 129 451 5.0E-29
sp|Q2K376|LEUC_RHIEC 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuC PE=3 SV=1 63 451 6.0E-29
sp|Q7U9J4|LEUC_SYNPX 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain WH8102) GN=leuC PE=3 SV=1 129 451 6.0E-29
sp|Q8G4W2|LEUC_BIFLO 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain NCC 2705) GN=leuC PE=3 SV=1 129 457 6.0E-29
sp|B3DPI2|LEUC_BIFLD 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain DJO10A) GN=leuC PE=3 SV=1 129 457 6.0E-29
sp|Q8DED9|LEUC_VIBVU 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain CMCP6) GN=leuC PE=3 SV=1 129 451 8.0E-29
sp|Q01Z81|LEUC_SOLUE 3-isopropylmalate dehydratase large subunit OS=Solibacter usitatus (strain Ellin6076) GN=leuC PE=3 SV=1 129 451 8.0E-29
sp|Q64QP1|LEUC_BACFR 3-isopropylmalate dehydratase large subunit OS=Bacteroides fragilis (strain YCH46) GN=leuC PE=3 SV=1 129 457 9.0E-29
sp|Q5LAB1|LEUC_BACFN 3-isopropylmalate dehydratase large subunit OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=leuC PE=3 SV=1 129 457 9.0E-29
sp|Q9EVI0|LEUC_BUCUO 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon obscurum GN=leuC PE=3 SV=1 129 428 9.0E-29
sp|Q15QR2|LEUC_PSEA6 3-isopropylmalate dehydratase large subunit OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=leuC PE=3 SV=1 30 439 1.0E-28
sp|Q6ND69|LEUC_RHOPA 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuC PE=3 SV=1 25 451 1.0E-28
sp|Q7MP79|LEUC_VIBVY 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain YJ016) GN=leuC PE=3 SV=1 129 451 1.0E-28
sp|Q9EVG8|LEUC_BUCUM 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuC PE=3 SV=2 129 428 1.0E-28
sp|C5CSH5|LEUC_VARPS 3-isopropylmalate dehydratase large subunit OS=Variovorax paradoxus (strain S110) GN=leuC PE=3 SV=1 129 451 1.0E-28
sp|Q98EF1|LEUC_RHILO 3-isopropylmalate dehydratase large subunit OS=Rhizobium loti (strain MAFF303099) GN=leuC PE=3 SV=1 28 451 1.0E-28
sp|Q393X2|LEUC_BURL3 3-isopropylmalate dehydratase large subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuC PE=3 SV=1 129 451 1.0E-28
sp|Q04DA3|LEUC_OENOB 3-isopropylmalate dehydratase large subunit OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=leuC PE=3 SV=1 129 428 2.0E-28
sp|Q11CQ6|LEUC_CHESB 3-isopropylmalate dehydratase large subunit OS=Chelativorans sp. (strain BNC1) GN=leuC PE=3 SV=1 28 451 2.0E-28
sp|Q1QAF2|LEUC_PSYCK 3-isopropylmalate dehydratase large subunit OS=Psychrobacter cryohalolentis (strain K5) GN=leuC PE=3 SV=1 129 451 2.0E-28
sp|Q5WPZ8|LEUC_BUCCC 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuC PE=3 SV=1 129 449 2.0E-28
sp|Q9EVH7|LEUC_BUCUH 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon helianthicola GN=leuC PE=3 SV=1 129 428 2.0E-28
sp|Q2T7H8|LEUC_BURTA 3-isopropylmalate dehydratase large subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuC PE=3 SV=1 129 451 2.0E-28
sp|Q2G958|LEUC_NOVAD 3-isopropylmalate dehydratase large subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuC PE=3 SV=1 129 451 2.0E-28
sp|A0AZ60|LEUC_BURCH 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain HI2424) GN=leuC PE=3 SV=1 129 451 2.0E-28
sp|B1K377|LEUC_BURCC 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain MC0-3) GN=leuC PE=3 SV=1 129 451 2.0E-28
sp|Q1BM55|LEUC_BURCA 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain AU 1054) GN=leuC PE=3 SV=1 129 451 2.0E-28
sp|B0U3M6|LEUC_XYLFM 3-isopropylmalate dehydratase large subunit OS=Xylella fastidiosa (strain M12) GN=leuC PE=3 SV=1 129 451 2.0E-28
sp|Q21IY3|LEUC_SACD2 3-isopropylmalate dehydratase large subunit OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuC PE=3 SV=1 129 451 2.0E-28
sp|Q21CT4|LEUC_RHOPB 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain BisB18) GN=leuC PE=3 SV=1 20 451 3.0E-28
sp|Q4FRU7|LEUC_PSYA2 3-isopropylmalate dehydratase large subunit OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuC PE=3 SV=1 129 451 3.0E-28
sp|C5BL66|LEUC_TERTT 3-isopropylmalate dehydratase large subunit OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=leuC PE=3 SV=1 129 451 3.0E-28
sp|A4SR64|LEUC_AERS4 3-isopropylmalate dehydratase large subunit OS=Aeromonas salmonicida (strain A449) GN=leuC PE=3 SV=1 129 449 3.0E-28
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.3536 0.2524 0.0994 0.0182 0.8288 0.0247 0.0372 0.0249 0.0321 0.0761

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup2695
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|083780
Agaricus bisporus var bisporus H97 AgabiH97|083780 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|26_7

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|083780
MHLVSRLRRTCDQRRFFATVTGDRSRTPQTIIEKIVQKYSVGLPEGKVVRTGDYVMIRPEHVMTHDNTGPVISKF
KSIGASKVHNPQQPVFTLDHDVQNKSPKNLAKYASIESFARNHDIDFFPARSRDSHSNMYGGVGCVGTPIVRTDA
AALWATGKTWWQVPRMVKVELKGKLAPGVTGKDVIVALCGSFNKDEVLNAAIEFSGDGIQALTIDDRLTIANMTT
EWGALVGFFPVDETTLQWYDNTLDKLELRTFSSTNSGIPPPPTHPRINRSRLDAIRKGIVQSDSEAQYASHLVFD
LSSLVPHVSGPNSVKISTPLPILEEKKIAINKAYLVSCTNSRLSDIAAAADAMKGHKVANGVEFYIAAASSAVQQ
EAERLGHWDILEQAGAKTLPAGCGPCIGLGTGLLEEGEVGISATNRNYKGRMGHPNAQAYLASPAVVAASAIRGY
ICGPSSLDSSTLPPTQAPTFSSSQTPSSPSTSAAPADEPLLEGFPRTFSGPLLFAPQDNLNTDGIYPGKYTYQDD
ITLERQAEVVMENYDPEFASLVASMTTKEVESQVVGGLKNGVVLVAGYNFGTGSSREQAATALKAAGIPLVIAGS
FGDIFKRNAINNGLVCIESPELVKDLTESYAKDGKRGSGGRNGEMTVDKGIHINVNMATGQVDVTGPLNKTYTVR
TVGPSVQELWLCGGLEGYILKEIQAHA*
Coding >AgabiH97|083780
ATGCACCTCGTGTCGCGGTTGCGTCGTACCTGCGACCAGCGCCGGTTCTTTGCCACTGTCACCGGCGACCGGTCT
CGAACACCACAAACAATCATCGAGAAGATCGTCCAAAAGTATAGCGTCGGTCTGCCAGAAGGGAAAGTCGTCAGA
ACCGGCGACTATGTGATGATTCGTCCAGAACATGTCATGACACACGACAATACAGGTCCTGTTATCAGCAAATTC
AAATCCATTGGTGCTTCTAAAGTTCACAACCCGCAACAACCGGTGTTCACTCTCGACCACGACGTGCAAAACAAA
TCTCCAAAGAACCTGGCTAAATATGCTTCCATTGAAAGCTTCGCAAGAAACCATGATATCGACTTCTTCCCTGCC
CGGTCGCGTGACAGTCATAGCAACATGTACGGTGGTGTTGGGTGTGTTGGAACACCTATTGTCCGCACTGATGCT
GCTGCATTGTGGGCAACTGGGAAAACATGGTGGCAGGTTCCTCGTATGGTGAAAGTCGAACTCAAGGGCAAACTC
GCTCCGGGGGTCACTGGAAAAGACGTCATCGTTGCGCTTTGTGGATCATTCAATAAAGATGAAGTCCTCAATGCA
GCTATCGAATTCTCTGGCGATGGAATTCAAGCCTTGACCATTGACGATCGTTTGACTATCGCAAATATGACGACA
GAATGGGGAGCTCTTGTTGGTTTCTTCCCGGTCGACGAGACGACACTGCAATGGTATGACAATACCTTGGACAAA
CTTGAATTGCGCACCTTTTCCTCCACCAACTCTGGCATACCTCCACCTCCTACTCATCCCCGTATCAATCGTTCA
CGACTCGATGCCATACGAAAGGGCATAGTCCAATCCGATTCCGAAGCTCAATATGCTTCTCATCTGGTTTTCGAC
CTATCCAGCCTAGTCCCTCATGTATCTGGTCCTAATAGCGTCAAAATATCTACGCCTCTTCCTATCCTCGAAGAA
AAGAAAATCGCCATCAATAAAGCCTATCTCGTCAGCTGCACGAATTCTCGCTTATCTGACATTGCGGCTGCTGCG
GACGCCATGAAAGGTCACAAAGTTGCAAACGGCGTTGAGTTCTATATCGCAGCGGCAAGTTCTGCTGTTCAACAG
GAAGCGGAACGCCTTGGACATTGGGATATACTTGAACAGGCGGGAGCGAAAACACTTCCTGCAGGGTGTGGCCCT
TGCATTGGTCTGGGGACAGGTCTTCTTGAAGAGGGTGAAGTCGGAATTAGCGCTACGAACAGGAATTATAAAGGG
CGCATGGGCCATCCGAATGCCCAGGCTTACCTTGCCAGTCCGGCGGTTGTTGCAGCCAGTGCTATCCGTGGCTAC
ATCTGTGGTCCATCATCTTTGGATAGCAGTACCCTACCCCCGACTCAGGCGCCTACCTTTTCTTCTTCCCAAACG
CCATCTTCTCCATCCACCTCCGCTGCCCCGGCTGATGAGCCCCTCCTTGAAGGTTTCCCTCGTACTTTCAGTGGA
CCTCTCTTATTTGCCCCACAGGACAACCTCAATACCGACGGCATTTACCCAGGAAAATATACGTATCAGGATGAT
ATTACGCTTGAACGCCAAGCGGAGGTTGTAATGGAGAACTACGACCCGGAATTTGCCTCTCTTGTGGCATCTATG
ACTACTAAGGAAGTAGAGTCTCAAGTCGTTGGGGGTCTCAAGAACGGCGTAGTGTTGGTTGCCGGTTATAACTTT
GGTACTGGTTCGTCTCGCGAACAGGCAGCCACCGCCCTCAAGGCTGCTGGTATCCCTCTTGTTATCGCAGGTTCC
TTTGGAGATATTTTCAAGCGTAACGCGATCAATAACGGTCTAGTGTGCATCGAGAGTCCCGAGCTTGTGAAAGAT
CTTACGGAATCTTATGCAAAGGACGGGAAGAGGGGCTCCGGGGGTAGGAATGGCGAGATGACGGTGGACAAGGGC
ATTCACATTAATGTCAACATGGCCACTGGTCAAGTTGATGTCACTGGTCCTCTGAATAAAACTTACACCGTTCGG
ACGGTGGGGCCTTCAGTTCAGGAACTTTGGCTCTGTGGCGGGCTCGAAGGCTACATCCTCAAGGAAATTCAAGCC
CATGCCTAG
Transcript >AgabiH97|083780
ATGCACCTCGTGTCGCGGTTGCGTCGTACCTGCGACCAGCGCCGGTTCTTTGCCACTGTCACCGGCGACCGGTCT
CGAACACCACAAACAATCATCGAGAAGATCGTCCAAAAGTATAGCGTCGGTCTGCCAGAAGGGAAAGTCGTCAGA
ACCGGCGACTATGTGATGATTCGTCCAGAACATGTCATGACACACGACAATACAGGTCCTGTTATCAGCAAATTC
AAATCCATTGGTGCTTCTAAAGTTCACAACCCGCAACAACCGGTGTTCACTCTCGACCACGACGTGCAAAACAAA
TCTCCAAAGAACCTGGCTAAATATGCTTCCATTGAAAGCTTCGCAAGAAACCATGATATCGACTTCTTCCCTGCC
CGGTCGCGTGACAGTCATAGCAACATGTACGGTGGTGTTGGGTGTGTTGGAACACCTATTGTCCGCACTGATGCT
GCTGCATTGTGGGCAACTGGGAAAACATGGTGGCAGGTTCCTCGTATGGTGAAAGTCGAACTCAAGGGCAAACTC
GCTCCGGGGGTCACTGGAAAAGACGTCATCGTTGCGCTTTGTGGATCATTCAATAAAGATGAAGTCCTCAATGCA
GCTATCGAATTCTCTGGCGATGGAATTCAAGCCTTGACCATTGACGATCGTTTGACTATCGCAAATATGACGACA
GAATGGGGAGCTCTTGTTGGTTTCTTCCCGGTCGACGAGACGACACTGCAATGGTATGACAATACCTTGGACAAA
CTTGAATTGCGCACCTTTTCCTCCACCAACTCTGGCATACCTCCACCTCCTACTCATCCCCGTATCAATCGTTCA
CGACTCGATGCCATACGAAAGGGCATAGTCCAATCCGATTCCGAAGCTCAATATGCTTCTCATCTGGTTTTCGAC
CTATCCAGCCTAGTCCCTCATGTATCTGGTCCTAATAGCGTCAAAATATCTACGCCTCTTCCTATCCTCGAAGAA
AAGAAAATCGCCATCAATAAAGCCTATCTCGTCAGCTGCACGAATTCTCGCTTATCTGACATTGCGGCTGCTGCG
GACGCCATGAAAGGTCACAAAGTTGCAAACGGCGTTGAGTTCTATATCGCAGCGGCAAGTTCTGCTGTTCAACAG
GAAGCGGAACGCCTTGGACATTGGGATATACTTGAACAGGCGGGAGCGAAAACACTTCCTGCAGGGTGTGGCCCT
TGCATTGGTCTGGGGACAGGTCTTCTTGAAGAGGGTGAAGTCGGAATTAGCGCTACGAACAGGAATTATAAAGGG
CGCATGGGCCATCCGAATGCCCAGGCTTACCTTGCCAGTCCGGCGGTTGTTGCAGCCAGTGCTATCCGTGGCTAC
ATCTGTGGTCCATCATCTTTGGATAGCAGTACCCTACCCCCGACTCAGGCGCCTACCTTTTCTTCTTCCCAAACG
CCATCTTCTCCATCCACCTCCGCTGCCCCGGCTGATGAGCCCCTCCTTGAAGGTTTCCCTCGTACTTTCAGTGGA
CCTCTCTTATTTGCCCCACAGGACAACCTCAATACCGACGGCATTTACCCAGGAAAATATACGTATCAGGATGAT
ATTACGCTTGAACGCCAAGCGGAGGTTGTAATGGAGAACTACGACCCGGAATTTGCCTCTCTTGTGGCATCTATG
ACTACTAAGGAAGTAGAGTCTCAAGTCGTTGGGGGTCTCAAGAACGGCGTAGTGTTGGTTGCCGGTTATAACTTT
GGTACTGGTTCGTCTCGCGAACAGGCAGCCACCGCCCTCAAGGCTGCTGGTATCCCTCTTGTTATCGCAGGTTCC
TTTGGAGATATTTTCAAGCGTAACGCGATCAATAACGGTCTAGTGTGCATCGAGAGTCCCGAGCTTGTGAAAGAT
CTTACGGAATCTTATGCAAAGGACGGGAAGAGGGGCTCCGGGGGTAGGAATGGCGAGATGACGGTGGACAAGGGC
ATTCACATTAATGTCAACATGGCCACTGGTCAAGTTGATGTCACTGGTCCTCTGAATAAAACTTACACCGTTCGG
ACGGTGGGGCCTTCAGTTCAGGAACTTTGGCTCTGTGGCGGGCTCGAAGGCTACATCCTCAAGGAAATTCAAGCC
CATGCCTAG
Gene >AgabiH97|083780
ATGCACCTCGTGTCGCGGTTGCGTCGTACCTGCGACCAGCGCCGGTTCTTTGCCACTGTCACCGGCGACCGGTCT
CGAACACCACAAACAATCATCGAGAAGATCGTCCAAAAGTATAGCGTCGGTCTGCCAGAAGGGAAAGTCGTCAGA
ACCGGCGACTATGTGATGATTCGTCCAGAACATGTCATGACACACGACAATACAGGTCCTGTTATCAGCAAGTTC
GTGTAACATACTATTGCTGAAGTTACCCCTCGTCAACTCAAATCTCCACAGATTCAAATCCATTGGTGCTTCTAA
AGTTCACAACCCGCAACAACCGGTGTTCACTCTCGACCACGACGTGCAAAACAAATCTCCAAAGAACCTGGCTAA
ATATGCTTCCATTGAAAGCTTCGCAAGAAACCATGATATCGACTTCTTCCCTGCCCGGTCGCGGTATTGGCCATC
AAATTCTCGTAGAGGAGGGATATGCTTTTCCTTATACTCTTACCGTCGCCAGTGACAGTCATAGCAACATGTACG
GTGGTGTTGGGTGTGTTGGAACACCTATTGTCCGCACTGATGCTGCTGCATTGTGGGCAACTGGGAAAACATGGT
GGCAGGTTCCTCGTATGGTGAAAGTCGAACTCAAGGGCAAACTCGCTCCGGGGGTCACTGGAAAAGACGTCATCG
TTGCGCTTTGTGGATCATTCAATAAAGATGAAGTCCTCAATGCAGCTATCGAATTCTCTGGCGATGGAATTCAAG
CCTTGACCATTGACGATCGTTTGACTATCGCAAATATGACGACAGAATGGGGAGCTCTTGTTGGTTTCTTCCCGG
TCGACGAGACGACACTGCAATGGTATGACAATACCTTGGACAAACTTGAATTGCGCACCTTTTCCTCCACCAACT
CTGGCATACCTCCACCTCCTACTCATCCCCGTATCAATCGTTCACGACTCGATGCCATACGAAAGGGCATAGTCC
AATCCGATTCCGAAGCTCAATATGCTTCTCATCTGGTTTTCGACCTATCCAGCCTAGTCCCTCATGTATCTGGTC
CTAATAGCGTCAAAATATCTACGCCTCTTCCTATCCTCGAAGAAAAGAAAATCGCCATCAATAAAGCCTATCTCG
TCAGCTGCACGAATTCTCGCTTATCTGACATTGCGGCTGCTGCGGACGCCATGAAAGGTCACAAAGTTGCAAACG
GCGTTGAGTTCTATATCGCAGCGGCAAGTTCTGCTGTTCAACAGGAAGCGGAACGCCTTGGACATTGGGATATAC
TTGAACAGGCGGGAGCGAAAACACTTCCTGCAGGGTGTGGCCCTTGCATTGGTCTGGGGACAGGTCTTCTTGAAG
AGGGTGAAGTCGGAATTAGCGCTACGAACAGGAATTATAAAGGGCGCATGGGCCATCCGAATGCCCAGGCTTACC
TTGCCAGTCCGGCGGTTGTTGCAGCCAGTGCTATCCGTGGCTACATCTGTGGTCCATCATCTTTGGATAGCAGTA
CCCTACCCCCGACTCAGGCGCCTACCTTTTCTTCTTCCCAAACGCCATCTTCTCCATCCACCTCCGCTGCCCCGG
CTGATGAGCCCCTCCTTGAAGGTTTCCCTCGTACTTTCAGTGGACCTCTCTTATTTGCCCCACAGGACAACCTCA
ATACCGACGGCATTTACCCAGGAAAATATACGTATCAGGATGATATTACGCTTGAACGCCAAGCGGAGGTTGTAA
TGGAGAACTACGACCCGGAATTTGCCTCTCTTGTGGCATCTATGACTACTAAGGAAGTAGAGTCTCAAGTCGTTG
GGGGTCTCAAGAACGGCGTAGTGTTGGTTGCCGGTTATAACTTTGGTACTGGTTCGTCTCGCGAACAGGCAGCCA
CCGCCCTCAAGGCTGCTGGTATCCCTCTTGTTATCGCAGGTTCCTTTGGAGATATTTTCAAGCGTAACGCGATCA
ATAACGGTCTAGTGTGCATCGAGAGTCCCGAGCTTGTGAAAGATCTTACGGAATCTTATGCAAAGGACGGGAAGA
GGGGCTCCGGGGGTAGGAATGGCGAGATGACGGTGGACAAGGGCATTCACATTAATGTCAACATGGCCACTGGTC
AAGTTGATGTCACTGGTCCTCTGAATAAAACTTACACCGTTCGGACGGTGGGGCCTTCAGTTCAGGAACTTTGGC
TCTGTGGCGGGCTCGAAGGCTACATCCTCAAGGAAATTCAAGCCCATGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail