Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|083730
Gene name
Locationscaffold_5:1379206..1381701
Strand-
Gene length (bp)2495
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.4E-49 157 460
PF00355 Rieske Rieske [2Fe-2S] domain 1.9E-15 32 117
PF14759 Reductase_C Reductase C-terminal 3.3E-08 480 552
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 3.3E-07 296 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10499|AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 55 560 2.0E-122
sp|Q3TY86|AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 39 543 7.0E-107
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 33 543 2.0E-106
sp|P43494|THCD_RHOER Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 157 550 2.0E-41
sp|Q84BZ0|ANDAA_BURCE Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia cepacia GN=andAa PE=1 SV=1 157 551 6.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10499|AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 55 560 2.0E-122
sp|Q3TY86|AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 39 543 7.0E-107
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 33 543 2.0E-106
sp|P43494|THCD_RHOER Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 157 550 2.0E-41
sp|Q84BZ0|ANDAA_BURCE Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia cepacia GN=andAa PE=1 SV=1 157 551 6.0E-34
sp|Q07946|BEDA_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 159 551 3.0E-33
sp|D5IGG6|FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. GN=fdr PE=1 SV=1 150 548 4.0E-33
sp|B5Z115|HCAD_ECO5E 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hcaD PE=3 SV=1 154 527 3.0E-32
sp|Q8XA71|HCAD_ECO57 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 GN=hcaD PE=3 SV=1 154 527 3.0E-32
sp|P37337|BPHG_BURXL Biphenyl dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia xenovorans (strain LB400) GN=bphG PE=3 SV=2 157 569 4.0E-32
sp|P17052|RURE_PSEOL Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=1 SV=1 156 502 1.0E-31
sp|Q9L4M8|RURE_PSEPU Rubredoxin-NAD(+) reductase OS=Pseudomonas putida GN=alkT PE=3 SV=1 156 502 2.0E-31
sp|B7NRJ1|HCAD_ECO7I 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hcaD PE=3 SV=1 154 527 6.0E-31
sp|B1LNJ8|HCAD_ECOSM 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hcaD PE=3 SV=1 154 527 7.0E-31
sp|Q9LK94|MDAR4_ARATH Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana GN=MDAR4 PE=1 SV=1 182 539 1.0E-29
sp|B7N6C9|HCAD_ECOLU 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hcaD PE=3 SV=1 154 527 2.0E-29
sp|P16640|CAMA_PSEPU Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 157 557 5.0E-29
sp|A5W4E9|TODA_PSEP1 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todA PE=1 SV=1 159 535 7.0E-29
sp|P77650|HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) GN=hcaD PE=1 SV=1 154 527 9.0E-29
sp|B1IVT5|HCAD_ECOLC 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hcaD PE=3 SV=1 154 527 9.0E-29
sp|A8A348|HCAD_ECOHS 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O9:H4 (strain HS) GN=hcaD PE=3 SV=1 154 527 9.0E-29
sp|B1XB17|HCAD_ECODH 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / DH10B) GN=hcaD PE=3 SV=1 154 527 9.0E-29
sp|C4ZXB7|HCAD_ECOBW 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hcaD PE=3 SV=1 154 527 9.0E-29
sp|Q0S032|BPHA4_RHOJR Biphenyl 2,3-dioxygenase, ferredoxin reductase component OS=Rhodococcus jostii (strain RHA1) GN=bphA4 PE=1 SV=1 169 543 1.0E-28
sp|B6I5B5|HCAD_ECOSE 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SE11) GN=hcaD PE=3 SV=1 154 527 1.0E-28
sp|B7LDD4|HCAD_ECO55 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain 55989 / EAEC) GN=hcaD PE=3 SV=1 154 527 1.0E-28
sp|A7ZPY5|HCAD_ECO24 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hcaD PE=3 SV=1 154 527 2.0E-28
sp|Q9GRX6|AIFM1_DICDI Apoptosis-inducing factor 1, mitochondrial OS=Dictyostelium discoideum GN=aif PE=2 SV=1 158 482 2.0E-28
sp|Q3YZ11|HCAD_SHISS 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella sonnei (strain Ss046) GN=hcaD PE=3 SV=1 154 527 3.0E-28
sp|Q58065|NAOX_METJA Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 158 483 5.0E-27
sp|P42435|NASD_BACSU Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 154 474 1.0E-26
sp|Q0T1X7|HCAD_SHIF8 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella flexneri serotype 5b (strain 8401) GN=hcaD PE=3 SV=1 154 527 1.0E-26
sp|Q9SR59|MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana GN=MDAR3 PE=2 SV=1 182 524 2.0E-26
sp|Q43497|MDAR_SOLLC Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1 150 551 7.0E-26
sp|Q40977|MDAR_PEA Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1 152 522 3.0E-25
sp|P0C621|TODA_PSEPU Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=todA PE=3 SV=1 159 535 8.0E-25
sp|P08087|BNZD_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=bnzD PE=3 SV=3 159 535 8.0E-25
sp|Q9VQ79|AIFM1_DROME Putative apoptosis-inducing factor 1, mitochondrial OS=Drosophila melanogaster GN=AIF PE=2 SV=2 158 492 1.0E-23
sp|Q7N4V5|HCAD_PHOLL 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaD PE=3 SV=1 157 527 4.0E-23
sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron transfer subunit OS=Bacillus subtilis (strain 168) GN=nasB PE=2 SV=2 154 469 1.0E-22
sp|P37062|NAPE_ENTFA NADH peroxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=npr PE=1 SV=2 222 503 1.0E-21
sp|Q8L3B0|PADH_AZOEV NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon OS=Azoarcus evansii GN=padH PE=1 SV=1 158 433 3.0E-21
sp|Q9LFA3|MDAR1_ARATH Monodehydroascorbate reductase 1, peroxisomal OS=Arabidopsis thaliana GN=MDAR1 PE=1 SV=1 150 522 4.0E-21
sp|Q9Z0X1|AIFM1_MOUSE Apoptosis-inducing factor 1, mitochondrial OS=Mus musculus GN=Aifm1 PE=1 SV=1 222 490 6.0E-21
sp|Q42711|MDARS_CUCSA Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1 182 544 7.0E-21
sp|Q9JM53|AIFM1_RAT Apoptosis-inducing factor 1, mitochondrial OS=Rattus norvegicus GN=Aifm1 PE=1 SV=1 222 490 7.0E-21
sp|O95831|AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens GN=AIFM1 PE=1 SV=1 222 490 8.0E-20
sp|Q93WJ8|MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana GN=MDAR2 PE=2 SV=1 182 573 1.0E-19
sp|P92947|MDAR5_ARATH Monodehydroascorbate reductase 5, mitochondrial OS=Arabidopsis thaliana GN=MDAR5 PE=1 SV=3 182 497 2.0E-19
sp|P33009|TERPA_PSESP Terpredoxin reductase OS=Pseudomonas sp. GN=terPA PE=4 SV=1 173 537 2.0E-18
sp|Q5JGP4|CDR_THEKO Coenzyme A disulfide reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1299 PE=3 SV=1 154 474 5.0E-18
sp|Q9AL95|NROR_CLOAB NADH-rubredoxin oxidoreductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nroR PE=1 SV=1 157 492 2.0E-17
sp|Q4L4Y7|CDR_STAHJ Coenzyme A disulfide reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cdr PE=3 SV=1 155 439 1.0E-16
sp|Q0VTB0|RURE_ALCBS Rubredoxin-NAD(+) reductase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rubB PE=1 SV=1 157 479 1.0E-15
sp|Q9HTK9|RURE_PSEAE Rubredoxin-NAD(+) reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=alkT PE=1 SV=1 152 438 2.0E-15
sp|Q8CPT6|CDR_STAES Coenzyme A disulfide reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cdr PE=3 SV=1 157 439 8.0E-15
sp|Q5HQI9|CDR_STAEQ Coenzyme A disulfide reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cdr PE=3 SV=1 157 439 8.0E-15
sp|P08201|NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 157 440 4.0E-14
sp|P42454|RURE_ACIAD Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rubB PE=1 SV=2 157 438 6.0E-14
sp|Q8U1M0|CDR_PYRFU Coenzyme A disulfide reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1186 PE=3 SV=1 206 474 7.0E-14
sp|B6I697|NORW_ECOSE Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 153 438 1.0E-13
sp|B2U036|NORW_SHIB3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=norW PE=3 SV=1 153 438 7.0E-13
sp|A0KEJ2|NORW_AERHH Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=norW PE=3 SV=1 148 440 8.0E-13
sp|Q06458|NIRB_KLEOX Nitrite reductase [NAD(P)H] large subunit OS=Klebsiella oxytoca GN=nasB PE=3 SV=1 157 440 9.0E-13
sp|Q7A6H1|CDR_STAAN Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain N315) GN=cdr PE=1 SV=3 202 439 1.0E-12
sp|Q99VC0|CDR_STAAM Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cdr PE=3 SV=3 202 439 1.0E-12
sp|A7X0I7|CDR_STAA1 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cdr PE=3 SV=1 202 439 1.0E-12
sp|Q3YYF3|NORW_SHISS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella sonnei (strain Ss046) GN=norW PE=3 SV=1 153 438 1.0E-12
sp|Q31X75|NORW_SHIBS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=norW PE=3 SV=2 153 438 1.0E-12
sp|A8A3I8|NORW_ECOHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O9:H4 (strain HS) GN=norW PE=3 SV=1 153 438 1.0E-12
sp|B7M9E8|NORW_ECO8A Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 153 438 1.0E-12
sp|B7LEC2|NORW_ECO55 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 153 438 1.0E-12
sp|B5Z372|NORW_ECO5E Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=norW PE=3 SV=1 153 438 1.0E-12
sp|Q8X850|NORW_ECO57 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 GN=norW PE=3 SV=1 153 438 1.0E-12
sp|Q0TEG9|NORW_ECOL5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=norW PE=3 SV=1 153 438 1.0E-12
sp|Q8NXE8|CDR_STAAW Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MW2) GN=cdr PE=3 SV=3 202 439 2.0E-12
sp|Q6GAV6|CDR_STAAS Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MSSA476) GN=cdr PE=3 SV=3 202 439 2.0E-12
sp|Q8FEN4|NORW_ECOL6 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=norW PE=3 SV=1 153 438 2.0E-12
sp|A7ZQE0|NORW_ECO24 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=norW PE=3 SV=1 153 438 2.0E-12
sp|Q9UYU5|CDR_PYRAB Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 206 474 2.0E-12
sp|Q1R7Y9|NORW_ECOUT Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=norW PE=3 SV=1 153 438 3.0E-12
sp|A1AEQ1|NORW_ECOK1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O1:K1 / APEC GN=norW PE=3 SV=1 153 438 3.0E-12
sp|B7MKI0|NORW_ECO45 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=norW PE=3 SV=1 153 438 3.0E-12
sp|B7MYL1|NORW_ECO81 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O81 (strain ED1a) GN=norW PE=3 SV=1 153 438 3.0E-12
sp|B5FG80|NORW_VIBFM Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain MJ11) GN=norW PE=3 SV=1 157 438 3.0E-12
sp|A5IRE8|CDR_STAA9 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain JH9) GN=cdr PE=3 SV=1 202 439 3.0E-12
sp|A6U077|CDR_STAA2 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain JH1) GN=cdr PE=3 SV=1 202 439 3.0E-12
sp|Q5HHB4|CDR_STAAC Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain COL) GN=cdr PE=3 SV=3 202 439 3.0E-12
sp|O52582|CDR_STAA8 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=cdr PE=1 SV=3 202 439 3.0E-12
sp|P22944|NIR_EMENI Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niiA PE=3 SV=2 145 440 3.0E-12
sp|B5XVA0|NORW_KLEP3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae (strain 342) GN=norW PE=3 SV=1 156 438 4.0E-12
sp|P59403|NORW_SHIFL Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri GN=norW PE=3 SV=1 153 438 5.0E-12
sp|Q0T1D6|NORW_SHIF8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=norW PE=3 SV=1 153 438 5.0E-12
sp|Q2YWW1|CDR_STAAB Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cdr PE=3 SV=1 202 439 6.0E-12
sp|A8Z076|CDR_STAAT Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cdr PE=3 SV=1 202 439 7.0E-12
sp|A6QFI1|CDR_STAAE Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Newman) GN=cdr PE=3 SV=1 202 439 7.0E-12
sp|Q2FIA5|CDR_STAA3 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300) GN=cdr PE=1 SV=1 202 439 7.0E-12
sp|B7NSJ1|NORW_ECO7I Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 153 438 7.0E-12
sp|P37596|NORW_ECOLI Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 153 438 9.0E-12
sp|B1IUW8|NORW_ECOLC Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 153 438 9.0E-12
sp|B1XCN8|NORW_ECODH Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 153 438 9.0E-12
sp|C4ZYV6|NORW_ECOBW Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 153 438 9.0E-12
sp|P75389|NAOX_MYCPN Probable NADH oxidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=nox PE=3 SV=1 202 469 1.0E-11
sp|B7UHC3|NORW_ECO27 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=norW PE=3 SV=1 153 438 1.0E-11
sp|B1LQ29|NORW_ECOSM Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=norW PE=3 SV=1 153 438 1.0E-11
sp|Q6GIB7|CDR_STAAR Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MRSA252) GN=cdr PE=3 SV=3 202 439 1.0E-11
sp|P37061|NAOX_ENTFA NADH oxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=nox PE=1 SV=1 183 474 2.0E-11
sp|Q32CL7|NORW_SHIDS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 153 438 3.0E-11
sp|A6TCX6|NORW_KLEP7 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=norW PE=3 SV=1 156 438 4.0E-11
sp|Q49WB0|CDR_STAS1 Coenzyme A disulfide reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cdr PE=3 SV=1 230 439 4.0E-11
sp|B7LW23|NORW_ESCF3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=norW PE=3 SV=1 153 438 5.0E-11
sp|B7N6U1|NORW_ECOLU Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=norW PE=3 SV=1 153 436 5.0E-11
sp|Q8GI16|CARAC_PSERE Ferredoxin CarAc OS=Pseudomonas resinovorans GN=carAc PE=1 SV=1 32 129 8.0E-11
sp|A2RIB7|NAOX_LACLM NADH oxidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=noxE PE=1 SV=1 203 472 9.0E-11
sp|A4STH3|NORW_AERS4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas salmonicida (strain A449) GN=norW PE=3 SV=1 150 440 2.0E-10
sp|A4WDR7|NORW_ENT38 Nitric oxide reductase FlRd-NAD(+) reductase OS=Enterobacter sp. (strain 638) GN=norW PE=3 SV=1 156 438 2.0E-10
sp|B4TF25|NORW_SALHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella heidelberg (strain SL476) GN=norW PE=3 SV=1 153 438 6.0E-10
sp|A9N0E0|NORW_SALPB Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=norW PE=3 SV=1 153 438 1.0E-09
sp|B5QV90|NORW_SALEP Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=norW PE=3 SV=1 153 438 3.0E-09
sp|Q8Z4C4|NORW_SALTI Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhi GN=norW PE=3 SV=1 153 438 3.0E-09
sp|B4TT18|NORW_SALSV Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=norW PE=3 SV=1 153 438 3.0E-09
sp|B5FSZ2|NORW_SALDC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella dublin (strain CT_02021853) GN=norW PE=3 SV=1 153 438 4.0E-09
sp|B5F365|NORW_SALA4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella agona (strain SL483) GN=norW PE=3 SV=1 153 438 4.0E-09
sp|B4T3B2|NORW_SALNS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella newport (strain SL254) GN=norW PE=3 SV=1 153 438 4.0E-09
sp|B5BEP9|NORW_SALPK Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=norW PE=3 SV=1 153 438 7.0E-09
sp|Q5PF36|NORW_SALPA Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=norW PE=3 SV=1 153 438 7.0E-09
sp|C0PWN3|NORW_SALPC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi C (strain RKS4594) GN=norW PE=3 SV=1 153 438 7.0E-09
sp|Q57KT2|NORW_SALCH Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella choleraesuis (strain SC-B67) GN=norW PE=3 SV=1 153 438 7.0E-09
sp|Q8ZMJ6|NORW_SALTY Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=norW PE=3 SV=1 153 438 1.0E-08
sp|A8GG95|NORW_SERP5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Serratia proteamaculans (strain 568) GN=norW PE=3 SV=1 156 438 1.0E-08
sp|B5RDG6|NORW_SALG2 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=norW PE=3 SV=1 153 438 1.0E-08
sp|O58308|CDR_PYRHO Coenzyme A disulfide reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0572 PE=1 SV=1 190 474 2.0E-08
sp|P39040|TYTR_CRIFA Trypanothione reductase OS=Crithidia fasciculata GN=TPR PE=1 SV=1 233 437 4.0E-08
sp|A8ANR8|NORW_CITK8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=norW PE=3 SV=1 153 438 5.0E-08
sp|Q04829|DLDH_HALVD Dihydrolipoyl dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=lpdA PE=1 SV=3 246 474 8.0E-08
sp|Q9HN74|DLDH_HALSA Dihydrolipoyl dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lpdA PE=3 SV=1 246 456 2.0E-07
sp|O04955|GSHRC_BRARP Glutathione reductase, cytosolic OS=Brassica rapa subsp. pekinensis GN=GR1 PE=2 SV=2 295 436 2.0E-07
sp|B5FXE5|AIFM2_TAEGU Apoptosis-inducing factor 2 OS=Taeniopygia guttata GN=AIFM2 PE=2 SV=1 207 443 4.0E-07
sp|P21880|DLDH1_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 244 457 5.0E-07
sp|Q43621|GSHRC_PEA Glutathione reductase, cytosolic OS=Pisum sativum PE=2 SV=1 236 437 8.0E-07
sp|Q54EW8|DLDH_DICDI Dihydrolipoyl dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=lpd PE=3 SV=1 229 444 9.0E-07
sp|Q7MBG9|STHA_PHOLL Soluble pyridine nucleotide transhydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=sthA PE=3 SV=1 210 444 9.0E-07
sp|P48641|GSHRC_ARATH Glutathione reductase, cytosolic OS=Arabidopsis thaliana GN=At3g24170 PE=2 SV=1 295 436 1.0E-06
sp|Q58931|TRXB_METJA Putative thioredoxin reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1536 PE=3 SV=1 230 437 1.0E-06
sp|P31023|DLDH_PEA Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2 234 478 2.0E-06
sp|P11959|DLDH1_GEOSE Dihydrolipoyl dehydrogenase OS=Geobacillus stearothermophilus GN=pdhD PE=1 SV=2 239 469 3.0E-06
sp|Q46136|UCRI_CHLTI Cytochrome b6-f complex iron-sulfur subunit OS=Chlorobaculum thiosulfatiphilum GN=petC PE=1 SV=2 29 129 6.0E-06
sp|D0VWY5|GASHR_MARGR Glutathione amide reductase OS=Marichromatium gracile GN=garB PE=1 SV=1 222 437 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0051536 iron-sulfur cluster binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0051540 metal cluster binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|083730
MISRNLFRNSLLSFHVVSTAWKKPLSTMVKTIAVLDESELQDGQMKEVDFDSGKVLLSRLGDRIQATSAWCTHYG
APLSKGVLVADGRVVCPWHGACFNVCTGDIEDAPALAAIHSFKTHVADGKIHVSAHPENTLKDNMRRYPGLLNED
TSFKKGLIIVGGGAGAFFAVDSLREYGYKLPITILSKEPHAPIDRTKLSKALITDPTGIILRTPADLKIKYGTTL
RLGVEVTSIDPKKKTVTIDNADTLTYEKLILAPGGIPRRLPIEGADLENVFTLRGVEDAKKIDAAAQEGKRAVVI
GSSFISMELVVAFGKRKLASIDVIGMEEFPFEAVLGKEVGGGQKKYHESQGIKFHMQTKVEKIVPKEDNPKLAGG
VVVNGTTIPADFVIMGVGVRPATDFLKGSGIEIEKDGSVRVDEYLRVRTGADTENIYAIGDIATYPAPAGVEKRI
EHWDVAGNHGRAAGKHICGKTVPFGTVPIFWSAQGGQLRYCGSSSKIDDVIVQGDPSQNKFIAFHVENGSVVAVS
SMQNDPIVTKSSQLLKVGLMPTPEELRAGKDVMSIDISTKDALKNVTS*
Coding >AgabiH97|083730
ATGATATCTAGAAACCTATTTCGCAACTCTCTCCTTTCTTTCCACGTCGTCTCCACCGCTTGGAAGAAACCGCTT
AGCACCATGGTCAAAACAATCGCCGTTCTCGATGAATCTGAGTTGCAAGATGGTCAAATGAAGGAAGTCGATTTC
GACTCTGGCAAAGTTCTTTTGTCACGTCTCGGAGACAGAATTCAAGCAACGAGTGCCTGGTGTACACATTATGGC
GCTCCGCTCTCAAAAGGTGTCCTCGTTGCTGACGGTCGTGTTGTTTGTCCATGGCACGGAGCTTGTTTCAATGTC
TGCACTGGCGATATTGAGGATGCGCCAGCATTAGCAGCCATTCATTCGTTCAAAACTCACGTCGCGGATGGAAAG
ATTCACGTCTCTGCTCACCCTGAAAATACCCTCAAGGACAATATGCGCAGATACCCGGGCCTACTCAATGAGGAT
ACCTCTTTCAAAAAAGGCTTAATCATTGTCGGGGGCGGCGCTGGTGCTTTTTTCGCTGTTGACAGCCTGCGCGAA
TATGGATATAAACTACCCATCACCATCTTATCCAAGGAACCTCATGCGCCTATCGACAGGACGAAGCTCAGTAAG
GCACTCATCACCGATCCTACGGGTATCATATTGAGGACACCTGCCGATTTGAAGATTAAGTATGGCACCACCCTT
CGCCTTGGAGTCGAGGTCACGTCCATAGATCCGAAGAAGAAGACTGTGACTATCGACAATGCAGATACACTCACA
TACGAGAAACTTATCCTCGCACCTGGAGGCATTCCTCGTAGGCTGCCGATCGAGGGTGCTGACCTTGAAAATGTC
TTTACTTTGCGTGGAGTCGAAGACGCAAAGAAAATCGACGCAGCGGCTCAAGAGGGTAAACGAGCCGTTGTTATC
GGTAGTTCTTTCATCAGCATGGAGCTGGTTGTTGCTTTTGGCAAGAGGAAGCTCGCATCTATTGATGTTATTGGA
ATGGAAGAGTTCCCTTTCGAAGCCGTACTTGGCAAGGAAGTTGGTGGAGGTCAGAAGAAATATCACGAATCTCAA
GGCATCAAATTCCACATGCAAACAAAAGTGGAGAAAATTGTACCCAAGGAAGATAATCCCAAACTTGCGGGAGGT
GTCGTCGTCAATGGTACGACCATTCCTGCTGACTTTGTGATTATGGGTGTTGGCGTGAGGCCTGCAACCGATTTC
CTGAAGGGCAGTGGAATCGAAATTGAGAAAGACGGCAGTGTGCGAGTAGATGAGTATCTTCGTGTCAGGACAGGC
GCCGATACCGAAAACATCTACGCTATCGGTGATATTGCCACATACCCTGCACCTGCTGGAGTAGAAAAGAGGATT
GAGCACTGGGATGTTGCTGGAAATCACGGACGCGCTGCGGGGAAACATATTTGTGGCAAAACAGTACCTTTTGGC
ACAGTACCTATCTTTTGGAGTGCTCAGGGCGGACAGTTACGTTATTGTGGTTCGAGTAGTAAGATAGACGACGTT
ATCGTGCAAGGGGATCCGTCGCAGAACAAGTTCATTGCATTCCATGTCGAGAATGGAAGTGTTGTTGCTGTTTCA
TCAATGCAGAATGACCCAATTGTCACCAAGTCGTCCCAATTATTGAAAGTAGGCCTCATGCCAACTCCTGAGGAG
CTGAGGGCAGGCAAGGATGTTATGAGCATCGATATTAGCACTAAAGACGCATTGAAGAATGTCACATCTTGA
Transcript >AgabiH97|083730
ATGATATCTAGAAACCTATTTCGCAACTCTCTCCTTTCTTTCCACGTCGTCTCCACCGCTTGGAAGAAACCGCTT
AGCACCATGGTCAAAACAATCGCCGTTCTCGATGAATCTGAGTTGCAAGATGGTCAAATGAAGGAAGTCGATTTC
GACTCTGGCAAAGTTCTTTTGTCACGTCTCGGAGACAGAATTCAAGCAACGAGTGCCTGGTGTACACATTATGGC
GCTCCGCTCTCAAAAGGTGTCCTCGTTGCTGACGGTCGTGTTGTTTGTCCATGGCACGGAGCTTGTTTCAATGTC
TGCACTGGCGATATTGAGGATGCGCCAGCATTAGCAGCCATTCATTCGTTCAAAACTCACGTCGCGGATGGAAAG
ATTCACGTCTCTGCTCACCCTGAAAATACCCTCAAGGACAATATGCGCAGATACCCGGGCCTACTCAATGAGGAT
ACCTCTTTCAAAAAAGGCTTAATCATTGTCGGGGGCGGCGCTGGTGCTTTTTTCGCTGTTGACAGCCTGCGCGAA
TATGGATATAAACTACCCATCACCATCTTATCCAAGGAACCTCATGCGCCTATCGACAGGACGAAGCTCAGTAAG
GCACTCATCACCGATCCTACGGGTATCATATTGAGGACACCTGCCGATTTGAAGATTAAGTATGGCACCACCCTT
CGCCTTGGAGTCGAGGTCACGTCCATAGATCCGAAGAAGAAGACTGTGACTATCGACAATGCAGATACACTCACA
TACGAGAAACTTATCCTCGCACCTGGAGGCATTCCTCGTAGGCTGCCGATCGAGGGTGCTGACCTTGAAAATGTC
TTTACTTTGCGTGGAGTCGAAGACGCAAAGAAAATCGACGCAGCGGCTCAAGAGGGTAAACGAGCCGTTGTTATC
GGTAGTTCTTTCATCAGCATGGAGCTGGTTGTTGCTTTTGGCAAGAGGAAGCTCGCATCTATTGATGTTATTGGA
ATGGAAGAGTTCCCTTTCGAAGCCGTACTTGGCAAGGAAGTTGGTGGAGGTCAGAAGAAATATCACGAATCTCAA
GGCATCAAATTCCACATGCAAACAAAAGTGGAGAAAATTGTACCCAAGGAAGATAATCCCAAACTTGCGGGAGGT
GTCGTCGTCAATGGTACGACCATTCCTGCTGACTTTGTGATTATGGGTGTTGGCGTGAGGCCTGCAACCGATTTC
CTGAAGGGCAGTGGAATCGAAATTGAGAAAGACGGCAGTGTGCGAGTAGATGAGTATCTTCGTGTCAGGACAGGC
GCCGATACCGAAAACATCTACGCTATCGGTGATATTGCCACATACCCTGCACCTGCTGGAGTAGAAAAGAGGATT
GAGCACTGGGATGTTGCTGGAAATCACGGACGCGCTGCGGGGAAACATATTTGTGGCAAAACAGTACCTTTTGGC
ACAGTACCTATCTTTTGGAGTGCTCAGGGCGGACAGTTACGTTATTGTGGTTCGAGTAGTAAGATAGACGACGTT
ATCGTGCAAGGGGATCCGTCGCAGAACAAGTTCATTGCATTCCATGTCGAGAATGGAAGTGTTGTTGCTGTTTCA
TCAATGCAGAATGACCCAATTGTCACCAAGTCGTCCCAATTATTGAAAGTAGGCCTCATGCCAACTCCTGAGGAG
CTGAGGGCAGGCAAGGATGTTATGAGCATCGATATTAGCACTAAAGACGCATTGAAGAATGTCACATCTTGA
Gene >AgabiH97|083730
ATGATATCTAGAAACCTATTTCGCAACTCTCTCCTTTCTTTCCACGTCGTCTCCACCGCTTGGAAGAAACCGCTT
AGCACCATGGTCAAAACAATCGCCGTTCTCGATGAATCTGAGTTGCAAGATGGTCAAATGTAAGTTGAGCCCCTC
GAAACTAATAGGTATCGGCTGATGACCGCTCGCTTGATATAGGAAGGAAGTCGATTTCGACTCTGGCAAAGTTCT
TTTGTCACGTCTCGGAGACAGAATTCAAGCAACGAGTGCCTGGTGTACACATTATGGCGCTCCGCTCTCAAAAGG
TGTCCTCGTTGCTGACGGTCGTGTTGTTTGGTGGGCTACAAATTGATCATCATCAATGATGTCACTGAAATTCGC
TGTCTATAGTCCATGGCACGGAGGTATATGCTTCGTTGACTCTTCTCTAAAATATACACTCACCTAAAATCAGCT
TGTTTCAATGTCTGCACTGGCGATATTGGTATGATGCGTCGTCCTTAGTACTCTCAATTGGTTTTTCATTCCTTT
GGGTAGAGGATGCGCCAGCATTAGCAGCCATTCATTCGTTCAAAACTCACGTCGCGGATGGAAAGATTCACGTCT
CTGCTCACCCTGAAAATACCCTCAAGGACAATATGCGCAGATACCCGGGCCTACTCAATGAGGATACCTCTTTCA
AAAAAGGCTTAATCATTGTCGGGGGCGGCGCTGGTGCTTTTTTCGCTGTTGACAGCCTGCGCGAAGTAGACGGTG
TTTGATTTTTTCCACGGAGTGATATTGACAGTCATCATTAGTATGGATATAAACTACCCATCACCATCTTATCCA
AGGAACCTCATGCGCCTATCGACAGGTATGTTTCCTTGACCTCAAAGTATCAAATTGCATATAAGCTATTGAATC
TAGGACGAAGCTCAGTAAGGCACTCATCACCGATCCTACGGGTATCATATTGAGGACACCTGCCGATTTGAAGAT
TAAGTATGGCACCACCCTTCGCCTTGGAGTCGTGCGTTCCCCCCTTGTTGTATTGTTATTGGTCCATTCATTGAA
TCATAACTTCGATAATAGGAGGTCACGTCCATAGATCCGAAGAAGAAGACTGTGACTATCGACAATGCAGATACA
CTCACATACGAGAAACTTATCCTCGCACCTGGAGGCATTCCTCGTAGGCTGCCGATCGAGGGTGCTGACCTTGAA
AATGTCTTTACTTTGCGTGGAGTCGAAGACGCAAAGAAAATCGACGCAGGTTAGTCTTTAGCTAGAACCTATCGG
TCGATTGAACGCTGATGCAACTCTAATGTGTACAGCGGCTCAAGAGGGTAAACGAGCCGTTGTTATCGGTAGTTC
TTTCATCAGCATGGAGCTGGTTGTTGCTTTTGGCAAGAGGAAGCTCGCATCTATTGATGTTATTGGAATGGAAGA
GTTCCCTTTCGAAGCCGTACTTGGCAAGGAAGTTGGTGGAGGTCAGAAGAAAGTGAGTTTTATGAATTTTGTATG
AATGCTGGCTTAGTTATTGTGACTACAGTATCACGAATCTCAAGGCATCAAATTCCACATGCAAACAAAAGTGGA
GAAAATTGTACCCAAGGAAGATAATCCCAAACTTGCGGGAGGTGTCGTCGTCAATGGTACGACCATTCCTGCTGA
CTTTGTGATTATGGGTGTTGGCGTGAGGCCTGCAACCGATTTCCTGAAGGGCAGTGGAATCGAAATTGAGAAAGA
CGGCAGTGTGCGAGTAGATGAGTATCTTCGTGTCAGGACAGGCGCCGATACCGAAAACATCTACGCTATCGGTGG
GCCAAAGTCTTTGTGACGCTTTGATGTTGTTAAATGCGCTTTTAGGTGATATTGCCACATACCCTGCACCTGCTG
GAGTAGAAAAGAGGATTGAGCACTGGGATGTAAGCGGGTGTTTGATATTCTTGAGCAAATTTTACTGACTGAATC
ATGCGTTGGTTATAGGTTGCTGGAAATCACGGACGCGCTGCGGGGAAACATATTTGTGGCAAAACAGTACCTTTT
GGCACAGTACCTATCTTTTGGAGTGCTCGTAAGTATTAATCTGGTAGTCCGTGTCCCATTTGTTCAACTGTATCA
GAGGGCGGACAGTTACGTTATTGTGGTTCGAGTAGTAAGATAGACGACGTTATCGTGCAAGGGGATCCGTCGCAG
AACAAGGTGCGTGGCCGACGATGTAATGCTACTGTCGATTCTGACTTTCCACCACTTTTCTATCATATTGCAGTT
CATTGCATTCCATGTCGAGAATGGAAGTGTTGTTGCTGTTTCATCAATGCAGAATGACCCAATTGTCACCAAGTC
GTCCCAATTATTGAAAGTAGGCCTCATGCCAACTCCTGAGGAGCTGAGGGCAGGCAAGGTAAGCGAATATACGGT
ACTACTCATCACGTTTTTGATTACTGACTGGATCACAGGATGTTATGAGCATCGATATTAGCACTAAAGACGCAT
TGAAGAATGTCACATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail