© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|083670 |
| Gene name | |
| Location | scaffold_5:1367631..1368755 |
| Strand | + |
| Gene length (bp) | 1124 |
| Transcript length (bp) | 666 |
| Coding sequence length (bp) | 666 |
| Protein length (aa) | 222 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00071 | Ras | Ras family | 4.4E-58 | 19 | 179 |
| PF08477 | Roc | Ras of Complex, Roc, domain of DAPkinase | 3.9E-20 | 19 | 133 |
| PF00025 | Arf | ADP-ribosylation factor family | 3.2E-09 | 14 | 174 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q05058|RASL_COPCI | 24 kDa Ras-like protein OS=Coprinopsis cinerea GN=CC-RAS PE=3 SV=1 | 9 | 220 | 3.0E-117 |
| sp|A8NU18|RASL_COPC7 | 24 kDa Ras-like protein OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC-RAS PE=3 SV=3 | 9 | 220 | 3.0E-117 |
| sp|P28775|RAS_LENED | Ras-like protein OS=Lentinula edodes PE=3 SV=1 | 9 | 221 | 2.0E-108 |
| sp|P0CQ42|RAS_CRYNJ | Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAS1 PE=2 SV=1 | 10 | 221 | 3.0E-102 |
| sp|P0CQ43|RAS_CRYNB | Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAS1 PE=3 SV=1 | 10 | 221 | 3.0E-102 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q05058|RASL_COPCI | 24 kDa Ras-like protein OS=Coprinopsis cinerea GN=CC-RAS PE=3 SV=1 | 9 | 220 | 3.0E-117 |
| sp|A8NU18|RASL_COPC7 | 24 kDa Ras-like protein OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC-RAS PE=3 SV=3 | 9 | 220 | 3.0E-117 |
| sp|P28775|RAS_LENED | Ras-like protein OS=Lentinula edodes PE=3 SV=1 | 9 | 221 | 2.0E-108 |
| sp|P0CQ42|RAS_CRYNJ | Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAS1 PE=2 SV=1 | 10 | 221 | 3.0E-102 |
| sp|P0CQ43|RAS_CRYNB | Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAS1 PE=3 SV=1 | 10 | 221 | 3.0E-102 |
| sp|Q12526|RAS_EMENI | Ras-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rasA PE=2 SV=2 | 12 | 221 | 3.0E-96 |
| sp|O42785|RASL_COLTR | Ras-like protein OS=Colletotrichum trifolii GN=RAS PE=2 SV=1 | 12 | 221 | 8.0E-96 |
| sp|P22278|RAS1_MUCCL | Ras-like protein 1 OS=Mucor circinelloides f. lusitanicus GN=RAS1 PE=2 SV=1 | 12 | 215 | 2.0E-95 |
| sp|O93856|RAS_LACBI | Ras-like protein OS=Laccaria bicolor PE=2 SV=1 | 12 | 221 | 4.0E-95 |
| sp|P22280|RAS3_MUCCL | Ras-like protein 3 OS=Mucor circinelloides f. lusitanicus GN=RAS3 PE=2 SV=1 | 10 | 221 | 2.0E-92 |
| sp|P87018|RAS_BOTFU | Ras-like protein OS=Botryotinia fuckeliana GN=ras1 PE=3 SV=1 | 12 | 221 | 1.0E-90 |
| sp|P08647|RAS_SCHPO | Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ras1 PE=3 SV=2 | 11 | 218 | 2.0E-87 |
| sp|P34729|RAS1_PHYPO | Ras-like protein 1 OS=Physarum polycephalum GN=RAS1 PE=2 SV=1 | 15 | 180 | 8.0E-81 |
| sp|P34726|RAS2_PHYPO | Ras-like protein 2 OS=Physarum polycephalum GN=RAS-2 PE=2 SV=1 | 17 | 180 | 2.0E-80 |
| sp|Q59XU5|RAS1_CANAL | Ras-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAS1 PE=3 SV=1 | 14 | 182 | 4.0E-80 |
| sp|C4YKT4|RAS1_CANAW | Ras-like protein 1 OS=Candida albicans (strain WO-1) GN=RAS1 PE=3 SV=1 | 14 | 182 | 4.0E-80 |
| sp|P0CY32|RAS1_CANAX | Ras-like protein 1 OS=Candida albicans GN=RAS1 PE=3 SV=1 | 14 | 182 | 5.0E-80 |
| sp|P15064|RASG_DICDI | Ras-like protein rasG OS=Dictyostelium discoideum GN=rasG PE=1 SV=1 | 15 | 180 | 3.0E-79 |
| sp|P22126|RAS1_NEUCR | Protein ras-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-1 PE=2 SV=1 | 13 | 221 | 5.0E-79 |
| sp|P22279|RAS2_MUCCL | Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 | 12 | 180 | 8.0E-79 |
| sp|P03967|RASD_DICDI | Ras-like protein rasD OS=Dictyostelium discoideum GN=rasD PE=2 SV=2 | 15 | 189 | 1.0E-78 |
| sp|P01120|RAS2_YEAST | Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS2 PE=1 SV=4 | 15 | 198 | 1.0E-75 |
| sp|P01119|RAS1_YEAST | Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS1 PE=1 SV=2 | 15 | 182 | 2.0E-74 |
| sp|P38976|RAS2_HYDVU | Ras-like protein RAS2 OS=Hydra vulgaris GN=RAS2 PE=2 SV=1 | 16 | 183 | 3.0E-73 |
| sp|P32253|RASC_DICDI | Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 | 19 | 197 | 8.0E-73 |
| sp|P01115|RASH_MSVHA | Transforming protein p29 OS=Harvey murine sarcoma virus GN=H-RAS PE=1 SV=1 | 5 | 182 | 5.0E-71 |
| sp|P32252|RASB_DICDI | Ras-like protein rasB OS=Dictyostelium discoideum GN=rasB PE=1 SV=1 | 17 | 197 | 1.0E-70 |
| sp|P23175|RASH_MSVNS | GTPase HRas OS=Murine sarcoma virus NS.C58 GN=H-RAS PE=3 SV=1 | 15 | 182 | 2.0E-70 |
| sp|P62071|RRAS2_MOUSE | Ras-related protein R-Ras2 OS=Mus musculus GN=Rras2 PE=1 SV=1 | 17 | 190 | 3.0E-70 |
| sp|P62070|RRAS2_HUMAN | Ras-related protein R-Ras2 OS=Homo sapiens GN=RRAS2 PE=1 SV=1 | 17 | 190 | 3.0E-70 |
| sp|P01113|RASH_MSVMO | GTPase HRas OS=Moloney murine sarcoma virus GN=H-RAS PE=3 SV=1 | 15 | 182 | 4.0E-70 |
| sp|P01114|RASH_RRASV | Transforming protein p29 OS=Rasheed rat sarcoma virus GN=RAS PE=3 SV=1 | 15 | 182 | 2.0E-69 |
| sp|P32254|RASS_DICDI | Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 | 18 | 191 | 2.0E-69 |
| sp|P01117|RASK_MSVKI | GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 | 15 | 181 | 3.0E-69 |
| sp|Q18246|RAP1_CAEEL | Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 | 15 | 181 | 2.0E-67 |
| sp|Q6TEN1|RAP1B_DANRE | Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 | 15 | 194 | 2.0E-67 |
| sp|Q5RDM6|RAP1B_PONAB | Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 | 15 | 180 | 2.0E-66 |
| sp|A5A6J7|RAP1B_PANTR | Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 | 15 | 180 | 2.0E-66 |
| sp|Q99JI6|RAP1B_MOUSE | Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 | 15 | 180 | 2.0E-66 |
| sp|Q4R9D4|RAP1B_MACFA | Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 | 15 | 180 | 2.0E-66 |
| sp|P61224|RAP1B_HUMAN | Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 | 15 | 180 | 2.0E-66 |
| sp|Q5ZHX1|RAP1B_CHICK | Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 | 15 | 180 | 2.0E-66 |
| sp|P61223|RAP1B_BOVIN | Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 | 15 | 180 | 2.0E-66 |
| sp|Q62636|RAP1B_RAT | Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 | 15 | 180 | 2.0E-66 |
| sp|Q55CC0|RASW_DICDI | Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 | 20 | 196 | 2.0E-66 |
| sp|Q9YH37|RAP1B_CYPCA | Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 | 15 | 180 | 3.0E-66 |
| sp|P04388|RAS2_DROME | Ras-like protein 2 OS=Drosophila melanogaster GN=Ras64B PE=1 SV=2 | 15 | 215 | 3.0E-66 |
| sp|P18262|RAS_ARTSA | Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 | 26 | 180 | 4.0E-66 |
| sp|P08645|RAS3_DROME | Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 | 15 | 178 | 6.0E-66 |
| sp|Q640R7|RAP1B_XENTR | Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 | 15 | 180 | 6.0E-66 |
| sp|Q7ZXH7|RAP1B_XENLA | Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 | 15 | 180 | 6.0E-66 |
| sp|Q55CB8|RASX_DICDI | Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 | 19 | 185 | 1.0E-65 |
| sp|P12825|RASN_CAVPO | GTPase NRas OS=Cavia porcellus GN=NRAS PE=2 SV=1 | 15 | 221 | 1.0E-65 |
| sp|O42277|RASK_ORYLA | GTPase KRas OS=Oryzias latipes GN=kras1 PE=2 SV=1 | 15 | 181 | 1.0E-65 |
| sp|Q55CB7|RASY_DICDI | Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 | 19 | 180 | 2.0E-65 |
| sp|P79800|RASK_MELGA | GTPase KRas OS=Meleagris gallopavo GN=KRAS PE=2 SV=1 | 15 | 183 | 2.0E-65 |
| sp|P22123|RAPA_DIPOM | Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 | 15 | 180 | 3.0E-65 |
| sp|Q55CA9|RASZ_DICDI | Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 | 19 | 180 | 3.0E-65 |
| sp|Q5F352|RASN_CHICK | GTPase NRas OS=Gallus gallus GN=NRAS PE=2 SV=1 | 15 | 221 | 3.0E-65 |
| sp|Q9YH38|RASK_CYPCA | GTPase KRas OS=Cyprinus carpio GN=kras PE=2 SV=1 | 15 | 181 | 3.0E-65 |
| sp|Q2MJK3|RASN_PIG | GTPase NRas OS=Sus scrofa GN=NRAS PE=2 SV=1 | 15 | 221 | 4.0E-65 |
| sp|P01111|RASN_HUMAN | GTPase NRas OS=Homo sapiens GN=NRAS PE=1 SV=1 | 15 | 221 | 4.0E-65 |
| sp|P08556|RASN_MOUSE | GTPase NRas OS=Mus musculus GN=Nras PE=1 SV=1 | 15 | 221 | 4.0E-65 |
| sp|P05774|RAS_CARAU | Ras-like protein (Fragment) OS=Carassius auratus PE=3 SV=1 | 15 | 181 | 6.0E-65 |
| sp|P62836|RAP1A_RAT | Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 | 15 | 180 | 8.0E-65 |
| sp|P62835|RAP1A_MOUSE | Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 | 15 | 180 | 8.0E-65 |
| sp|P62834|RAP1A_HUMAN | Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 | 15 | 180 | 8.0E-65 |
| sp|P62833|RAP1A_BOVIN | Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 | 15 | 180 | 8.0E-65 |
| sp|P01116|RASK_HUMAN | GTPase KRas OS=Homo sapiens GN=KRAS PE=1 SV=1 | 15 | 181 | 8.0E-65 |
| sp|Q95ME4|RASN_MONDO | GTPase NRas OS=Monodelphis domestica GN=NRAS PE=2 SV=1 | 15 | 221 | 9.0E-65 |
| sp|P08642|RASH_CHICK | GTPase HRas OS=Gallus gallus GN=HRAS PE=1 SV=1 | 15 | 220 | 1.0E-64 |
| sp|A6NIZ1|RP1BL_HUMAN | Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1 | 15 | 180 | 1.0E-64 |
| sp|Q5RD87|RASN_PONAB | GTPase NRas OS=Pongo abelii GN=NRAS PE=2 SV=1 | 15 | 221 | 2.0E-64 |
| sp|Q04970|RASN_RAT | GTPase NRas OS=Rattus norvegicus GN=Nras PE=1 SV=1 | 15 | 221 | 2.0E-64 |
| sp|P20171|RASH_RAT | GTPase HRas OS=Rattus norvegicus GN=Hras PE=1 SV=2 | 15 | 197 | 3.0E-64 |
| sp|Q61411|RASH_MOUSE | GTPase HRas OS=Mus musculus GN=Hras PE=1 SV=2 | 15 | 197 | 3.0E-64 |
| sp|P01112|RASH_HUMAN | GTPase HRas OS=Homo sapiens GN=HRAS PE=1 SV=1 | 15 | 197 | 3.0E-64 |
| sp|P08644|RASK_RAT | GTPase KRas OS=Rattus norvegicus GN=Kras PE=1 SV=3 | 15 | 181 | 4.0E-64 |
| sp|P32883|RASK_MOUSE | GTPase KRas OS=Mus musculus GN=Kras PE=1 SV=1 | 15 | 181 | 4.0E-64 |
| sp|Q07983|RASK_MONDO | GTPase KRas OS=Monodelphis domestica GN=KRAS PE=1 SV=1 | 15 | 183 | 8.0E-64 |
| sp|B4NJ72|RAS1_DROWI | Ras-like protein 1 OS=Drosophila willistoni GN=Ras85D PE=3 SV=1 | 15 | 192 | 9.0E-64 |
| sp|Q05147|RASK_XENLA | GTPase KRas OS=Xenopus laevis GN=kras PE=2 SV=1 | 15 | 183 | 1.0E-63 |
| sp|Q295X7|RAS1_DROPS | Ras-like protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=Ras85D PE=3 SV=1 | 15 | 192 | 1.0E-63 |
| sp|B4GFJ8|RAS1_DROPE | Ras-like protein 1 OS=Drosophila persimilis GN=Ras85D PE=3 SV=1 | 15 | 192 | 1.0E-63 |
| sp|Q91806|RASN_XENLA | GTPase NRas OS=Xenopus laevis GN=nras PE=2 SV=1 | 15 | 181 | 1.0E-63 |
| sp|B4PUP5|RAS1_DROYA | Ras-like protein 1 OS=Drosophila yakuba GN=Ras85D PE=3 SV=1 | 15 | 189 | 1.0E-63 |
| sp|P83831|RAS1_DROSI | Ras-like protein 1 OS=Drosophila simulans GN=Ras85D PE=3 SV=1 | 15 | 189 | 1.0E-63 |
| sp|B4HKC7|RAS1_DROSE | Ras-like protein 1 OS=Drosophila sechellia GN=Ras85D PE=3 SV=1 | 15 | 189 | 1.0E-63 |
| sp|P08646|RAS1_DROME | Ras-like protein 1 OS=Drosophila melanogaster GN=Ras85D PE=1 SV=2 | 15 | 189 | 1.0E-63 |
| sp|P83832|RAS1_DROMA | Ras-like protein 1 OS=Drosophila mauritiana GN=Ras85D PE=3 SV=1 | 15 | 189 | 1.0E-63 |
| sp|B3NZR4|RAS1_DROER | Ras-like protein 1 OS=Drosophila erecta GN=Ras85D PE=3 SV=1 | 15 | 189 | 1.0E-63 |
| sp|B3M185|RAS1_DROAN | Ras-like protein 1 OS=Drosophila ananassae GN=Ras85D PE=3 SV=1 | 15 | 189 | 1.0E-63 |
| sp|B4JFU8|RAS1_DROGR | Ras-like protein 1 OS=Drosophila grimshawi GN=Ras85D PE=3 SV=1 | 15 | 190 | 2.0E-63 |
| sp|B4LY29|RAS1_DROVI | Ras-like protein 1 OS=Drosophila virilis GN=Ras85D PE=3 SV=1 | 15 | 190 | 2.0E-63 |
| sp|Q5EFX7|RASK_KRYMA | GTPase KRas OS=Kryptolebias marmoratus GN=kras PE=2 SV=1 | 15 | 181 | 2.0E-63 |
| sp|Q01387|RAS2_NEUCR | Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 | 18 | 214 | 3.0E-63 |
| sp|P70426|RIT1_MOUSE | GTP-binding protein Rit1 OS=Mus musculus GN=Rit1 PE=1 SV=1 | 6 | 184 | 6.0E-63 |
| sp|O08989|RASM_MOUSE | Ras-related protein M-Ras OS=Mus musculus GN=Mras PE=1 SV=1 | 6 | 180 | 2.0E-62 |
| sp|Q94694|RAP1_PHYPO | Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 | 15 | 196 | 3.0E-62 |
| sp|P18613|RAPA_DICDI | Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 | 15 | 182 | 3.0E-62 |
| sp|P97538|RASM_RAT | Ras-related protein M-Ras OS=Rattus norvegicus GN=Mras PE=1 SV=2 | 6 | 180 | 4.0E-62 |
| sp|P22981|LET60_CAEEL | Ras protein let-60 OS=Caenorhabditis elegans GN=let-60 PE=1 SV=1 | 15 | 190 | 6.0E-62 |
| sp|Q92963|RIT1_HUMAN | GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 | 9 | 184 | 9.0E-62 |
| sp|O14807|RASM_HUMAN | Ras-related protein M-Ras OS=Homo sapiens GN=MRAS PE=1 SV=2 | 6 | 180 | 1.0E-61 |
| sp|P79737|RASN_DANRE | GTPase NRas OS=Danio rerio GN=nras PE=2 SV=1 | 15 | 189 | 1.0E-61 |
| sp|P10301|RRAS_HUMAN | Ras-related protein R-Ras OS=Homo sapiens GN=RRAS PE=1 SV=1 | 18 | 200 | 1.0E-61 |
| sp|P10833|RRAS_MOUSE | Ras-related protein R-Ras OS=Mus musculus GN=Rras PE=1 SV=1 | 18 | 200 | 1.0E-61 |
| sp|B4KB60|RAS1_DROMO | Ras-like protein 1 OS=Drosophila mojavensis GN=Ras85D PE=3 SV=1 | 15 | 190 | 2.0E-61 |
| sp|D3Z8L7|RRAS_RAT | Ras-related protein R-Ras OS=Rattus norvegicus GN=Rras PE=1 SV=1 | 18 | 190 | 4.0E-61 |
| sp|P70425|RIT2_MOUSE | GTP-binding protein Rit2 OS=Mus musculus GN=Rit2 PE=1 SV=1 | 16 | 180 | 1.0E-59 |
| sp|Q5BJQ5|RIT2_RAT | GTP-binding protein Rit2 OS=Rattus norvegicus GN=Rit2 PE=2 SV=1 | 16 | 180 | 2.0E-59 |
| sp|Q99578|RIT2_HUMAN | GTP-binding protein Rit2 OS=Homo sapiens GN=RIT2 PE=1 SV=1 | 16 | 180 | 5.0E-59 |
| sp|Q9YH09|RALBA_XENLA | Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 | 5 | 179 | 2.0E-58 |
| sp|Q6IP71|RALBB_XENLA | Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 | 5 | 179 | 2.0E-58 |
| sp|Q5R4B8|RALB_PONAB | Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 | 5 | 179 | 3.0E-58 |
| sp|P11234|RALB_HUMAN | Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 | 5 | 179 | 3.0E-58 |
| sp|Q4R379|RALB_MACFA | Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 | 5 | 179 | 4.0E-58 |
| sp|Q9JIW9|RALB_MOUSE | Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 | 5 | 179 | 1.0E-57 |
| sp|P36860|RALB_RAT | Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 | 5 | 179 | 2.0E-57 |
| sp|P22124|RAL_DIPOM | Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 | 5 | 179 | 8.0E-57 |
| sp|P51539|RAS1_HYDVU | Ras-like protein RAS1 OS=Hydra vulgaris GN=RAS1 PE=2 SV=2 | 17 | 186 | 2.0E-56 |
| sp|Q55CB0|RASU_DICDI | Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 | 19 | 180 | 2.0E-56 |
| sp|Q55CB9|RASV_DICDI | Ras-like protein rasV OS=Dictyostelium discoideum GN=rasV PE=3 SV=1 | 19 | 175 | 2.0E-55 |
| sp|P11233|RALA_HUMAN | Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 | 5 | 179 | 3.0E-55 |
| sp|P48555|RALA_DROME | Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 | 18 | 179 | 3.0E-55 |
| sp|P63320|RALA_SAGOE | Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 | 5 | 179 | 4.0E-55 |
| sp|P63322|RALA_RAT | Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 | 5 | 179 | 4.0E-55 |
| sp|P63321|RALA_MOUSE | Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 | 5 | 179 | 4.0E-55 |
| sp|P13856|RSR1_YEAST | Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 | 15 | 178 | 6.0E-55 |
| sp|Q5R988|RAP2A_PONAB | Ras-related protein Rap-2a OS=Pongo abelii GN=RAP2A PE=2 SV=2 | 15 | 220 | 1.0E-53 |
| sp|Q80ZJ1|RAP2A_MOUSE | Ras-related protein Rap-2a OS=Mus musculus GN=Rap2a PE=1 SV=2 | 15 | 220 | 1.0E-53 |
| sp|P61227|RAP2B_RAT | Ras-related protein Rap-2b OS=Rattus norvegicus GN=Rap2b PE=2 SV=1 | 15 | 221 | 3.0E-52 |
| sp|P61226|RAP2B_MOUSE | Ras-related protein Rap-2b OS=Mus musculus GN=Rap2b PE=1 SV=1 | 15 | 221 | 3.0E-52 |
| sp|P61225|RAP2B_HUMAN | Ras-related protein Rap-2b OS=Homo sapiens GN=RAP2B PE=1 SV=1 | 15 | 221 | 3.0E-52 |
| sp|Q06AU2|RAP2A_PIG | Ras-related protein Rap-2a OS=Sus scrofa GN=RAP2A PE=2 SV=1 | 15 | 221 | 3.0E-52 |
| sp|Q8BU31|RAP2C_MOUSE | Ras-related protein Rap-2c OS=Mus musculus GN=Rap2c PE=1 SV=1 | 15 | 178 | 8.0E-51 |
| sp|Q9Y3L5|RAP2C_HUMAN | Ras-related protein Rap-2c OS=Homo sapiens GN=RAP2C PE=1 SV=1 | 15 | 178 | 8.0E-51 |
| sp|Q08DI5|RAP2C_BOVIN | Ras-related protein Rap-2c OS=Bos taurus GN=RAP2C PE=2 SV=1 | 15 | 178 | 8.0E-51 |
| sp|Q86L51|RAPB_DICDI | Ras-related protein rapB OS=Dictyostelium discoideum GN=rapB PE=3 SV=1 | 20 | 192 | 8.0E-51 |
| sp|P10114|RAP2A_HUMAN | Ras-related protein Rap-2a OS=Homo sapiens GN=RAP2A PE=1 SV=1 | 15 | 220 | 1.0E-47 |
| sp|P52498|RSR1_CANAX | Ras-related protein RSR1 OS=Candida albicans GN=RSR1 PE=3 SV=1 | 15 | 180 | 4.0E-46 |
| sp|Q0VCJ7|RERG_BOVIN | Ras-related and estrogen-regulated growth inhibitor OS=Bos taurus GN=RERG PE=2 SV=1 | 17 | 180 | 3.0E-42 |
| sp|Q96A58|RERG_HUMAN | Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1 | 17 | 180 | 6.0E-42 |
| sp|Q8R367|RERG_MOUSE | Ras-related and estrogen-regulated growth inhibitor OS=Mus musculus GN=Rerg PE=2 SV=1 | 17 | 180 | 8.0E-42 |
| sp|Q95KD9|DIRA2_MACFA | GTP-binding protein Di-Ras2 OS=Macaca fascicularis GN=DIRAS2 PE=2 SV=1 | 17 | 175 | 8.0E-42 |
| sp|Q5R6S2|DIRA2_PONAB | GTP-binding protein Di-Ras2 OS=Pongo abelii GN=DIRAS2 PE=2 SV=1 | 17 | 175 | 1.0E-41 |
| sp|Q96HU8|DIRA2_HUMAN | GTP-binding protein Di-Ras2 OS=Homo sapiens GN=DIRAS2 PE=1 SV=1 | 17 | 175 | 2.0E-41 |
| sp|Q5PR73|DIRA2_MOUSE | GTP-binding protein Di-Ras2 OS=Mus musculus GN=Diras2 PE=1 SV=1 | 17 | 175 | 2.0E-41 |
| sp|Q60529|RASH_MESAU | GTPase HRas (Fragment) OS=Mesocricetus auratus GN=HRAS PE=3 SV=1 | 15 | 110 | 1.0E-38 |
| sp|Q55BW0|RAPC_DICDI | Ras-related protein rapC OS=Dictyostelium discoideum GN=rapC PE=3 SV=1 | 15 | 178 | 1.0E-37 |
| sp|Q75J93|CPAS1_DICDI | Circularly permutated Ras protein 1 OS=Dictyostelium discoideum GN=cpras1 PE=3 SV=1 | 63 | 176 | 3.0E-37 |
| sp|Q9VND8|RHEB_DROME | GTP-binding protein Rheb homolog OS=Drosophila melanogaster GN=Rheb PE=2 SV=1 | 16 | 195 | 3.0E-36 |
| sp|O94363|RHB1_SCHPO | GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 | 15 | 188 | 7.0E-36 |
| sp|P24498|RAS_GEOCY | Ras-like protein OS=Geodia cydonium PE=2 SV=1 | 15 | 189 | 1.0E-35 |
| sp|Q7Z444|RASE_HUMAN | GTPase ERas OS=Homo sapiens GN=ERAS PE=2 SV=1 | 15 | 183 | 1.0E-34 |
| sp|Q550Q4|RHEB_DICDI | GTP-binding protein Rheb homolog OS=Dictyostelium discoideum GN=rheb PE=3 SV=1 | 16 | 180 | 2.0E-34 |
| sp|Q7SZ59|RASLC_DANRE | Ras-like protein family member 12 OS=Danio rerio GN=RASL12 PE=2 SV=1 | 17 | 194 | 8.0E-34 |
| sp|Q921J2|RHEB_MOUSE | GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 | 19 | 189 | 3.0E-33 |
| sp|Q15382|RHEB_HUMAN | GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 | 19 | 189 | 4.0E-33 |
| sp|Q62639|RHEB_RAT | GTP-binding protein Rheb OS=Rattus norvegicus GN=Rheb PE=1 SV=1 | 19 | 189 | 5.0E-33 |
| sp|Q56JV3|RHEB_BOVIN | GTP-binding protein Rheb OS=Bos taurus GN=RHEB PE=2 SV=1 | 19 | 189 | 2.0E-32 |
| sp|Q7TN89|RASE_MOUSE | GTPase ERas OS=Mus musculus GN=Eras PE=1 SV=1 | 15 | 180 | 2.0E-32 |
| sp|O95057|DIRA1_HUMAN | GTP-binding protein Di-Ras1 OS=Homo sapiens GN=DIRAS1 PE=1 SV=1 | 30 | 175 | 5.0E-32 |
| sp|Q91Z61|DIRA1_MOUSE | GTP-binding protein Di-Ras1 OS=Mus musculus GN=Diras1 PE=1 SV=1 | 17 | 175 | 1.0E-31 |
| sp|Q91079|RAS_LIMLI | Ras-like protein (Fragment) OS=Limanda limanda GN=ras PE=3 SV=1 | 30 | 110 | 2.0E-31 |
| sp|A8XAD0|RHEB1_CAEBR | GTP-binding protein Rheb homolog 1 OS=Caenorhabditis briggsae GN=rheb-1 PE=3 SV=1 | 6 | 178 | 3.0E-31 |
| sp|P51153|RAB13_HUMAN | Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 | 18 | 209 | 6.0E-31 |
| sp|Q08E00|RASLC_BOVIN | Ras-like protein family member 12 OS=Bos taurus GN=RASL12 PE=2 SV=1 | 17 | 214 | 8.0E-31 |
| sp|P34443|RHEB1_CAEEL | GTP-binding protein Rheb homolog 1 OS=Caenorhabditis elegans GN=rheb-1 PE=3 SV=1 | 19 | 178 | 9.0E-31 |
| sp|Q54BW4|CPAS2_DICDI | Circularly permutated Ras protein 2 OS=Dictyostelium discoideum GN=cpras2 PE=3 SV=1 | 66 | 196 | 1.0E-30 |
| sp|Q8TAI7|REBL1_HUMAN | GTPase RhebL1 OS=Homo sapiens GN=RHEBL1 PE=1 SV=1 | 14 | 180 | 1.0E-30 |
| sp|Q58DS5|RAB13_BOVIN | Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 | 18 | 178 | 1.0E-30 |
| sp|P55041|GEM_MOUSE | GTP-binding protein GEM OS=Mus musculus GN=Gem PE=1 SV=2 | 18 | 179 | 7.0E-30 |
| sp|P17609|YPT2_SCHPO | GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 | 19 | 186 | 8.0E-30 |
| sp|P92963|RAB1C_ARATH | Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 | 18 | 216 | 8.0E-30 |
| sp|Q9DD03|RAB13_MOUSE | Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 | 18 | 178 | 1.0E-29 |
| sp|P41924|RYL1_YARLI | Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 | 19 | 215 | 1.0E-29 |
| sp|O23657|RABC1_ARATH | Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 | 7 | 178 | 2.0E-29 |
| sp|Q5R541|GEM_PONAB | GTP-binding protein GEM OS=Pongo abelii GN=GEM PE=2 SV=1 | 18 | 179 | 2.0E-29 |
| sp|Q08AT1|RASLC_MOUSE | Ras-like protein family member 12 OS=Mus musculus GN=Rasl12 PE=2 SV=1 | 17 | 191 | 2.0E-29 |
| sp|Q5KTJ6|RAB13_MESAU | Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 | 18 | 178 | 2.0E-29 |
| sp|P55040|GEM_HUMAN | GTP-binding protein GEM OS=Homo sapiens GN=GEM PE=1 SV=1 | 18 | 179 | 2.0E-29 |
| sp|F1PTE3|RAB13_CANLF | Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 | 18 | 178 | 3.0E-29 |
| sp|Q7TNZ5|REBL1_RAT | GTPase RhebL1 OS=Rattus norvegicus GN=Rhebl1 PE=2 SV=1 | 14 | 180 | 4.0E-29 |
| sp|P20790|RAB8A_DICDI | Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 | 1 | 215 | 5.0E-29 |
| sp|P35286|RAB13_RAT | Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 | 18 | 178 | 6.0E-29 |
| sp|Q7YS69|REBL1_BOVIN | GTPase RhebL1 OS=Bos taurus GN=RHEBL1 PE=2 SV=1 | 29 | 180 | 1.0E-28 |
| sp|Q7T3A4|RAB13_DANRE | Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 | 9 | 178 | 2.0E-28 |
| sp|O23561|RAB1A_ARATH | Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 | 18 | 216 | 3.0E-28 |
| sp|Q38922|RAB1B_ARATH | Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 | 18 | 216 | 3.0E-28 |
| sp|Q9D8T3|REBL1_MOUSE | GTPase RhebL1 OS=Mus musculus GN=Rhebl1 PE=2 SV=1 | 14 | 180 | 6.0E-28 |
| sp|Q8WUD1|RAB2B_HUMAN | Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 | 18 | 197 | 7.0E-28 |
| sp|Q96D21|RHES_HUMAN | GTP-binding protein Rhes OS=Homo sapiens GN=RASD2 PE=1 SV=1 | 18 | 171 | 8.0E-28 |
| sp|P22125|RAB1_DIPOM | Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 | 18 | 215 | 9.0E-28 |
| sp|Q9Y272|RASD1_HUMAN | Dexamethasone-induced Ras-related protein 1 OS=Homo sapiens GN=RASD1 PE=1 SV=1 | 18 | 174 | 1.0E-27 |
| sp|O35626|RASD1_MOUSE | Dexamethasone-induced Ras-related protein 1 OS=Mus musculus GN=Rasd1 PE=1 SV=1 | 18 | 174 | 1.0E-27 |
| sp|Q9JKF8|RASD1_RAT | Dexamethasone-induced Ras-related protein 1 OS=Rattus norvegicus GN=Rasd1 PE=1 SV=1 | 18 | 174 | 1.0E-27 |
| sp|P20791|RAB8B_DICDI | Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 | 1 | 180 | 1.0E-27 |
| sp|Q39570|YPTC4_CHLRE | GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 | 18 | 184 | 2.0E-27 |
| sp|P63033|RHES_RAT | GTP-binding protein Rhes OS=Rattus norvegicus GN=Rasd2 PE=1 SV=1 | 18 | 171 | 2.0E-27 |
| sp|P63032|RHES_MOUSE | GTP-binding protein Rhes OS=Mus musculus GN=Rasd2 PE=2 SV=1 | 18 | 171 | 2.0E-27 |
| sp|Q92928|RAB1C_HUMAN | Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 | 18 | 215 | 2.0E-27 |
| sp|P36863|YPTV4_VOLCA | GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 | 18 | 184 | 2.0E-27 |
| sp|Q8BHC1|RB39B_MOUSE | Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 | 11 | 178 | 3.0E-27 |
| sp|Q17QU4|RB39B_BOVIN | Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 | 11 | 178 | 3.0E-27 |
| sp|P59279|RAB2B_MOUSE | Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 | 18 | 197 | 3.0E-27 |
| sp|Q96DA2|RB39B_HUMAN | Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 | 11 | 178 | 3.0E-27 |
| sp|P36409|RAB2A_DICDI | Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 | 18 | 215 | 5.0E-27 |
| sp|P53994|RAB2A_MOUSE | Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 | 18 | 186 | 5.0E-27 |
| sp|Q01971|RAB2A_RABIT | Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 | 18 | 186 | 6.0E-27 |
| sp|Q90965|RAB2A_CHICK | Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 | 18 | 186 | 7.0E-27 |
| sp|Q5R6B6|RAB2A_PONAB | Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 | 18 | 186 | 7.0E-27 |
| sp|Q4R4X6|RAB2A_MACFA | Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 | 18 | 186 | 7.0E-27 |
| sp|P61019|RAB2A_HUMAN | Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 | 18 | 186 | 7.0E-27 |
| sp|P61105|RAB2A_CANLF | Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 | 18 | 186 | 7.0E-27 |
| sp|P25228|RAB3_DROME | Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 | 9 | 199 | 8.0E-27 |
| sp|Q05975|RAB2_LYMST | Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 | 18 | 184 | 8.0E-27 |
| sp|O49513|RAA1E_ARATH | Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 | 18 | 217 | 9.0E-27 |
| sp|Q6NYB7|RAB1A_RAT | Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 | 18 | 215 | 1.0E-26 |
| sp|P62821|RAB1A_MOUSE | Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 | 18 | 215 | 1.0E-26 |
| sp|P62820|RAB1A_HUMAN | Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 | 18 | 215 | 1.0E-26 |
| sp|P62822|RAB1A_CANLF | Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 | 18 | 215 | 1.0E-26 |
| sp|Q52NJ2|RAB1A_PIG | Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 | 18 | 215 | 1.0E-26 |
| sp|Q94986|RAB3_CAEEL | Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 | 18 | 178 | 1.0E-26 |
| sp|Q8IYK8|REM2_HUMAN | GTP-binding protein REM 2 OS=Homo sapiens GN=REM2 PE=1 SV=2 | 9 | 199 | 1.0E-26 |
| sp|P34140|RAB1B_DICDI | Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 | 18 | 180 | 1.0E-26 |
| sp|Q40723|RLGP2_ORYSJ | Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 | 18 | 178 | 2.0E-26 |
| sp|Q5REC9|RAB8B_PONAB | Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 | 18 | 200 | 2.0E-26 |
| sp|P05712|RAB2A_RAT | Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 | 18 | 186 | 2.0E-26 |
| sp|Q9ZRE2|RABD1_ARATH | Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 | 18 | 216 | 2.0E-26 |
| sp|Q5F470|RAB8A_CHICK | Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 | 18 | 221 | 2.0E-26 |
| sp|P35276|RAB3D_MOUSE | Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 | 9 | 214 | 2.0E-26 |
| sp|P70550|RAB8B_RAT | Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 | 18 | 200 | 2.0E-26 |
| sp|P61028|RAB8B_MOUSE | Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 | 18 | 200 | 2.0E-26 |
| sp|P16976|YPTM1_MAIZE | GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 | 18 | 192 | 2.0E-26 |
| sp|Q92930|RAB8B_HUMAN | Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 | 18 | 200 | 2.0E-26 |
| sp|Q63942|RAB3D_RAT | GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 | 9 | 214 | 3.0E-26 |
| sp|Q54NU2|RAB1D_DICDI | Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 | 7 | 190 | 5.0E-26 |
| sp|A4FV54|RAB8A_BOVIN | Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 | 18 | 198 | 5.0E-26 |
| sp|P35280|RAB8A_RAT | Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 | 18 | 198 | 5.0E-26 |
| sp|P55258|RAB8A_MOUSE | Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 | 18 | 198 | 5.0E-26 |
| sp|Q4R5P1|RAB8A_MACFA | Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 | 18 | 198 | 5.0E-26 |
| sp|P61006|RAB8A_HUMAN | Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 | 18 | 198 | 5.0E-26 |
| sp|P61007|RAB8A_CANLF | Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 | 18 | 198 | 5.0E-26 |
| sp|Q4R8X3|RAB1B_MACFA | Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 | 18 | 215 | 5.0E-26 |
| sp|P63012|RAB3A_RAT | Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 | 1 | 190 | 5.0E-26 |
| sp|Q06AU3|RAB3A_PIG | Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 | 1 | 190 | 5.0E-26 |
| sp|P63011|RAB3A_MOUSE | Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 | 1 | 190 | 5.0E-26 |
| sp|Q4R4R9|RAB3A_MACFA | Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 | 1 | 190 | 5.0E-26 |
| sp|P20336|RAB3A_HUMAN | Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 | 1 | 190 | 5.0E-26 |
| sp|Q2HJI8|RAB8B_BOVIN | Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 | 18 | 200 | 6.0E-26 |
| sp|Q9NYN1|RASLC_HUMAN | Ras-like protein family member 12 OS=Homo sapiens GN=RASL12 PE=1 SV=1 | 17 | 214 | 6.0E-26 |
| sp|Q559X6|RAB2B_DICDI | Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 | 18 | 180 | 7.0E-26 |
| sp|Q6GQP4|RAB31_RAT | Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 | 15 | 215 | 7.0E-26 |
| sp|Q01890|YPT1_PHYIN | Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 | 18 | 215 | 7.0E-26 |
| sp|P10948|RAB3B_BOVIN | Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 | 9 | 178 | 7.0E-26 |
| sp|Q63941|RAB3B_RAT | Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 | 3 | 190 | 8.0E-26 |
| sp|Q9CZT8|RAB3B_MOUSE | Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 | 9 | 190 | 8.0E-26 |
| sp|Q5KTJ7|RAB3B_MESAU | Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 | 9 | 178 | 9.0E-26 |
| sp|O95716|RAB3D_HUMAN | Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 | 9 | 178 | 9.0E-26 |
| sp|Q40191|RB11A_LOTJA | Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 | 10 | 204 | 9.0E-26 |
| sp|Q86JP3|RAB5A_DICDI | Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 | 17 | 215 | 1.0E-25 |
| sp|P11023|RAB3A_BOVIN | Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 | 18 | 190 | 1.0E-25 |
| sp|Q99260|YPT6_YEAST | GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 | 15 | 200 | 1.0E-25 |
| sp|P10949|RAB3C_BOVIN | Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 | 18 | 175 | 1.0E-25 |
| sp|Q9LNW1|RAA2B_ARATH | Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 | 18 | 216 | 2.0E-25 |
| sp|Q96E17|RAB3C_HUMAN | Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 | 18 | 175 | 2.0E-25 |
| sp|Q9SEH3|RAD2C_ARATH | Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 | 18 | 217 | 2.0E-25 |
| sp|P22128|RAB8_DIPOM | Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 | 18 | 183 | 2.0E-25 |
| sp|Q39433|RB1BV_BETVU | Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 | 19 | 217 | 3.0E-25 |
| sp|P35281|RAB10_RAT | Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 | 18 | 204 | 3.0E-25 |
| sp|Q5RE13|RAB1B_PONAB | Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 | 18 | 215 | 3.0E-25 |
| sp|Q9H0U4|RAB1B_HUMAN | Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 | 18 | 215 | 3.0E-25 |
| sp|Q2HJH2|RAB1B_BOVIN | Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 | 18 | 215 | 3.0E-25 |
| sp|P40392|RIC1_ORYSJ | Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 | 18 | 179 | 3.0E-25 |
| sp|P20337|RAB3B_HUMAN | Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 | 9 | 178 | 4.0E-25 |
| sp|Q95UJ0|RAB7A_PAROT | Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 | 18 | 190 | 5.0E-25 |
| sp|Q6IMA3|RSLBA_RAT | Ras-like protein family member 11A OS=Rattus norvegicus GN=Rasl11a PE=2 SV=2 | 16 | 182 | 5.0E-25 |
| sp|Q39571|YPTC1_CHLRE | GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 | 18 | 215 | 5.0E-25 |
| sp|Q5R7L7|RAB5C_PONAB | Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 | 17 | 215 | 5.0E-25 |
| sp|P51148|RAB5C_HUMAN | Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 | 17 | 215 | 5.0E-25 |
| sp|Q5ZIT5|RAB10_CHICK | Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 | 18 | 204 | 5.0E-25 |
| sp|O24466|RAE1A_ARATH | Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 | 19 | 216 | 5.0E-25 |
| sp|Q9SMR4|RAH1C_ARATH | Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 | 10 | 174 | 6.0E-25 |
| sp|Q6DUB4|RAB7B_PAROT | Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 | 18 | 190 | 6.0E-25 |
| sp|Q921E2|RAB31_MOUSE | Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 | 15 | 178 | 6.0E-25 |
| sp|P62824|RAB3C_RAT | Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 | 18 | 175 | 7.0E-25 |
| sp|P62823|RAB3C_MOUSE | Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 | 18 | 175 | 7.0E-25 |
| sp|P49104|RAB2B_MAIZE | Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 | 18 | 184 | 7.0E-25 |
| sp|Q9ULC3|RAB23_HUMAN | Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 | 19 | 220 | 7.0E-25 |
| sp|O35929|REM1_MOUSE | GTP-binding protein REM 1 OS=Mus musculus GN=Rem1 PE=1 SV=1 | 18 | 184 | 8.0E-25 |
| sp|Q5R5U1|RAB10_PONAB | Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 | 18 | 204 | 8.0E-25 |
| sp|P61027|RAB10_MOUSE | Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 | 18 | 204 | 8.0E-25 |
| sp|P61026|RAB10_HUMAN | Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 | 18 | 204 | 8.0E-25 |
| sp|Q6IMA7|RSLBB_RAT | Ras-like protein family member 11B OS=Rattus norvegicus GN=Rasl11b PE=2 SV=1 | 16 | 190 | 9.0E-25 |
| sp|P36862|YPTV3_VOLCA | GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 | 18 | 178 | 9.0E-25 |
| sp|P22129|RB11B_DIPOM | Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 | 18 | 197 | 1.0E-24 |
| sp|Q6IMB1|RSLBA_MOUSE | Ras-like protein family member 11A OS=Mus musculus GN=Rasl11a PE=1 SV=1 | 16 | 183 | 1.0E-24 |
| sp|Q9LK99|RAA1G_ARATH | Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 | 18 | 217 | 1.0E-24 |
| sp|P35285|RB22A_MOUSE | Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 | 15 | 215 | 1.0E-24 |
| sp|P10536|RAB1B_RAT | Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 | 18 | 180 | 1.0E-24 |
| sp|Q9D1G1|RAB1B_MOUSE | Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 | 18 | 180 | 1.0E-24 |
| sp|Q05974|RAB1A_LYMST | Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 | 18 | 179 | 1.0E-24 |
| sp|P49103|RAB2A_MAIZE | Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 | 18 | 184 | 1.0E-24 |
| sp|Q8VEL9|REM2_MOUSE | GTP-binding protein REM 2 OS=Mus musculus GN=Rem2 PE=1 SV=2 | 18 | 212 | 1.0E-24 |
| sp|P24409|RAB10_CANLF | Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 | 18 | 204 | 1.0E-24 |
| sp|Q58DS9|RAB5C_BOVIN | Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 | 17 | 215 | 1.0E-24 |
| sp|Q9WTY2|REM2_RAT | GTP-binding protein REM 2 OS=Rattus norvegicus GN=Rem2 PE=1 SV=2 | 9 | 212 | 2.0E-24 |
| sp|Q6P0U3|RSLBB_DANRE | Ras-like protein family member 11B OS=Danio rerio GN=rasl11b PE=2 SV=1 | 1 | 196 | 2.0E-24 |
| sp|P35278|RAB5C_MOUSE | Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 | 17 | 215 | 2.0E-24 |
| sp|Q9C9U7|RAA6A_ARATH | Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 | 18 | 205 | 2.0E-24 |
| sp|Q9H0T7|RAB17_HUMAN | Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 | 7 | 216 | 2.0E-24 |
| sp|Q9SMQ6|RAA4B_ARATH | Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 | 18 | 204 | 2.0E-24 |
| sp|Q06AU7|RAB1B_PIG | Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 | 18 | 215 | 3.0E-24 |
| sp|O35509|RB11B_RAT | Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 | 18 | 197 | 3.0E-24 |
| sp|Q15907|RB11B_HUMAN | Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 | 18 | 197 | 3.0E-24 |
| sp|Q3MHP2|RB11B_BOVIN | Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 | 18 | 197 | 3.0E-24 |
| sp|Q3T0F5|RAB7A_BOVIN | Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 | 19 | 214 | 3.0E-24 |
| sp|Q13636|RAB31_HUMAN | Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1 | 15 | 185 | 3.0E-24 |
| sp|Q1ZXE7|RABZ_DICDI | Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 | 18 | 191 | 3.0E-24 |
| sp|P35288|RAB23_MOUSE | Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 | 19 | 220 | 3.0E-24 |
| sp|P46638|RB11B_MOUSE | Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 | 18 | 197 | 3.0E-24 |
| sp|Q5R4A3|RAB8A_PONAB | Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 | 18 | 221 | 3.0E-24 |
| sp|P22127|RAB10_DIPOM | Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 | 18 | 199 | 3.0E-24 |
| sp|Q40521|RB11B_TOBAC | Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 | 18 | 217 | 3.0E-24 |
| sp|P01123|YPT1_YEAST | GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 | 18 | 215 | 4.0E-24 |
| sp|O49841|RAC2A_ARATH | Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 | 7 | 178 | 4.0E-24 |
| sp|Q5ZHW4|RAB5B_CHICK | Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 | 1 | 216 | 5.0E-24 |
| sp|Q96AX2|RAB37_HUMAN | Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 | 19 | 190 | 5.0E-24 |
| sp|P28186|RAE1C_ARATH | Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 | 19 | 184 | 5.0E-24 |
| sp|Q9BPW5|RSLBB_HUMAN | Ras-like protein family member 11B OS=Homo sapiens GN=RASL11B PE=2 SV=1 | 16 | 190 | 5.0E-24 |
| sp|P55042|RAD_HUMAN | GTP-binding protein RAD OS=Homo sapiens GN=RRAD PE=1 SV=2 | 18 | 179 | 5.0E-24 |
| sp|P40393|RIC2_ORYSJ | Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 | 18 | 217 | 5.0E-24 |
| sp|P36861|YPTV2_VOLCA | GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 | 19 | 178 | 6.0E-24 |
| sp|M0RC99|RAB5A_RAT | Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 | 1 | 188 | 6.0E-24 |
| sp|P51147|RAB5C_CANLF | Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 | 17 | 195 | 6.0E-24 |
| sp|Q5FVY2|RSLBB_XENTR | Ras-like protein family member 11B OS=Xenopus tropicalis GN=rasl11b PE=2 SV=1 | 16 | 190 | 7.0E-24 |
| sp|Q922H7|RSLBB_MOUSE | Ras-like protein family member 11B OS=Mus musculus GN=Rasl11b PE=2 SV=1 | 16 | 190 | 7.0E-24 |
| sp|Q9JKM7|RAB37_MOUSE | Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 | 19 | 190 | 7.0E-24 |
| sp|P25378|RHEB_YEAST | Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHB1 PE=1 SV=2 | 19 | 180 | 7.0E-24 |
| sp|Q39222|RAA1B_ARATH | Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 | 18 | 216 | 7.0E-24 |
| sp|P0CY30|SEC4_CANAX | Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 | 19 | 180 | 8.0E-24 |
| sp|C4YL11|SEC4_CANAW | Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 | 19 | 180 | 8.0E-24 |
| sp|P0CY31|SEC4_CANAL | Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 | 19 | 180 | 8.0E-24 |
| sp|P61271|RAB5A_MACFA | Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 | 1 | 188 | 8.0E-24 |
| sp|P18066|RAB5A_CANLF | Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 | 1 | 188 | 8.0E-24 |
| sp|P51154|RB22A_CANLF | Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 | 15 | 188 | 8.0E-24 |
| sp|Q9CQD1|RAB5A_MOUSE | Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 | 1 | 188 | 8.0E-24 |
| sp|Q0IIG7|RAB5A_BOVIN | Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 | 1 | 188 | 9.0E-24 |
| sp|Q39572|YPTC6_CHLRE | Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 | 18 | 216 | 9.0E-24 |
| sp|Q01111|YPT3_NICPL | Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 | 18 | 217 | 9.0E-24 |
| sp|P28187|RAA5C_ARATH | Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 | 18 | 178 | 9.0E-24 |
| sp|P17610|YPT3_SCHPO | GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 | 18 | 207 | 9.0E-24 |
| sp|P36411|RAB7A_DICDI | Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 | 19 | 176 | 9.0E-24 |
| sp|Q5RBG1|RAB5B_PONAB | Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 | 11 | 217 | 9.0E-24 |
| sp|P61021|RAB5B_MOUSE | Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 | 11 | 217 | 9.0E-24 |
| sp|P61020|RAB5B_HUMAN | Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 | 11 | 217 | 9.0E-24 |
| sp|Q06AU6|RAB5A_PIG | Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 | 1 | 188 | 1.0E-23 |
| sp|P34143|RABC_DICDI | Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 | 18 | 189 | 1.0E-23 |
| sp|O76173|RAB1C_DICDI | Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 | 19 | 180 | 1.0E-23 |
| sp|P20339|RAB5A_HUMAN | Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 | 17 | 188 | 1.0E-23 |
| sp|Q9UL26|RB22A_HUMAN | Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 | 15 | 188 | 1.0E-23 |
| sp|Q05737|YPTM2_MAIZE | GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 | 18 | 198 | 1.0E-23 |
| sp|P33723|YPT1_NEUCR | GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 | 18 | 215 | 1.0E-23 |
| sp|P59190|RAB15_HUMAN | Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 | 18 | 195 | 1.0E-23 |
| sp|Q39434|RB2BV_BETVU | Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 | 18 | 195 | 2.0E-23 |
| sp|Q1RMR4|RAB15_BOVIN | Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 | 18 | 188 | 2.0E-23 |
| sp|P36412|RB11A_DICDI | Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 | 6 | 195 | 2.0E-23 |
| sp|O97572|RAB7A_RABIT | Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 | 19 | 214 | 2.0E-23 |
| sp|P51156|RAB26_RAT | Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 | 18 | 180 | 2.0E-23 |
| sp|Q9FPJ4|RAD2B_ARATH | Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 | 18 | 217 | 2.0E-23 |
| sp|P35282|RAB21_MOUSE | Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 | 18 | 218 | 2.0E-23 |
| sp|O88667|RAD_MOUSE | GTP-binding protein RAD OS=Mus musculus GN=Rrad PE=1 SV=1 | 18 | 179 | 2.0E-23 |
| sp|Q6T310|RSLBA_HUMAN | Ras-like protein family member 11A OS=Homo sapiens GN=RASL11A PE=2 SV=1 | 16 | 182 | 3.0E-23 |
| sp|O42819|SEC4_CANGA | Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 | 19 | 215 | 3.0E-23 |
| sp|O95661|DIRA3_HUMAN | GTP-binding protein Di-Ras3 OS=Homo sapiens GN=DIRAS3 PE=1 SV=1 | 15 | 188 | 3.0E-23 |
| sp|P31584|YPTV1_VOLCA | GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 | 18 | 179 | 3.0E-23 |
| sp|O75628|REM1_HUMAN | GTP-binding protein REM 1 OS=Homo sapiens GN=REM1 PE=1 SV=2 | 18 | 171 | 4.0E-23 |
| sp|Q54GY8|RAB18_DICDI | Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 | 16 | 207 | 4.0E-23 |
| sp|Q9ULW5|RAB26_HUMAN | Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 | 18 | 180 | 4.0E-23 |
| sp|Q29RR0|RAB26_BOVIN | Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 | 18 | 180 | 4.0E-23 |
| sp|Q9SRS5|RAA5B_ARATH | Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 | 18 | 178 | 5.0E-23 |
| sp|Q550H6|RB11C_DICDI | Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 | 11 | 178 | 5.0E-23 |
| sp|P35289|RAB15_RAT | Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 | 18 | 188 | 5.0E-23 |
| sp|P28188|RAD2A_ARATH | Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 | 18 | 190 | 5.0E-23 |
| sp|Q5E9J3|RSLBB_BOVIN | Ras-like protein family member 11B OS=Bos taurus GN=RASL11B PE=2 SV=1 | 16 | 190 | 5.0E-23 |
| sp|Q40193|RB11C_LOTJA | Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 | 18 | 215 | 6.0E-23 |
| sp|Q40194|RB11D_LOTJA | Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 | 18 | 216 | 6.0E-23 |
| sp|Q8K386|RAB15_MOUSE | Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 | 18 | 188 | 6.0E-23 |
| sp|P19892|RAA5E_ARATH | Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 | 18 | 182 | 7.0E-23 |
| sp|P34139|RAB1A_DICDI | Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 | 18 | 179 | 7.0E-23 |
| sp|Q1PEX3|RAA1H_ARATH | Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 | 18 | 178 | 8.0E-23 |
| sp|O04486|RAA2A_ARATH | Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 | 18 | 188 | 8.0E-23 |
| sp|Q98932|RAB5C_CHICK | Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 | 17 | 190 | 8.0E-23 |
| sp|Q17R06|RAB21_BOVIN | Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 | 18 | 215 | 9.0E-23 |
| sp|Q9FJN8|RAA4A_ARATH | Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 | 18 | 190 | 9.0E-23 |
| sp|Q8AVS6|RSLBB_XENLA | Ras-like protein family member 11B OS=Xenopus laevis GN=rasl11b PE=2 SV=1 | 16 | 188 | 1.0E-22 |
| sp|P51150|RAB7A_MOUSE | Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 | 19 | 180 | 1.0E-22 |
| sp|P51149|RAB7A_HUMAN | Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 | 19 | 180 | 1.0E-22 |
| sp|Q5R9Y4|RAB7A_PONAB | Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 | 19 | 180 | 1.0E-22 |
| sp|P18067|RAB7A_CANLF | Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 | 19 | 214 | 1.0E-22 |
| sp|P09527|RAB7A_RAT | Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 | 19 | 180 | 1.0E-22 |
| sp|Q9SIP0|RAA5D_ARATH | Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 | 18 | 178 | 1.0E-22 |
| sp|P35292|RAB17_MOUSE | Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 | 19 | 193 | 1.0E-22 |
| sp|Q8MXS1|RAB18_CAEEL | Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 | 15 | 190 | 1.0E-22 |
| sp|P90726|RAB18_CAEBR | Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 | 15 | 200 | 2.0E-22 |
| sp|Q24192|RHOL_DROME | Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 | 16 | 183 | 2.0E-22 |
| sp|P28185|RAA1A_ARATH | Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 | 18 | 215 | 2.0E-22 |
| sp|Q504M8|RAB26_MOUSE | Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 | 18 | 180 | 2.0E-22 |
| sp|P62494|RB11A_RAT | Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 | 18 | 189 | 2.0E-22 |
| sp|P62493|RB11A_RABIT | Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 | 18 | 189 | 2.0E-22 |
| sp|Q5R9M7|RB11A_PONAB | Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 | 18 | 189 | 2.0E-22 |
| sp|Q52NJ1|RB11A_PIG | Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 | 18 | 189 | 2.0E-22 |
| sp|P62492|RB11A_MOUSE | Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 | 18 | 189 | 2.0E-22 |
| sp|P62491|RB11A_HUMAN | Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 | 18 | 189 | 2.0E-22 |
| sp|Q5ZJN2|RB11A_CHICK | Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 | 18 | 189 | 2.0E-22 |
| sp|P62490|RB11A_CANLF | Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 | 18 | 189 | 2.0E-22 |
| sp|Q9UL25|RAB21_HUMAN | Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 | 18 | 215 | 2.0E-22 |
| sp|Q9SN35|RAA1D_ARATH | Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 | 18 | 178 | 3.0E-22 |
| sp|Q96283|RAA2C_ARATH | Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 | 18 | 178 | 3.0E-22 |
| sp|Q9S810|RAA1I_ARATH | Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 | 18 | 217 | 3.0E-22 |
| sp|P38555|YPT31_YEAST | GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 | 18 | 215 | 3.0E-22 |
| sp|Q9FIF9|RAA2D_ARATH | Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 | 18 | 178 | 3.0E-22 |
| sp|Q9FJH0|RAA1F_ARATH | Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 | 18 | 178 | 3.0E-22 |
| sp|Q9FK68|RAA1C_ARATH | Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 | 18 | 217 | 4.0E-22 |
| sp|Q40523|RB11A_TOBAC | Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 | 18 | 218 | 4.0E-22 |
| sp|Q2TA29|RB11A_BOVIN | Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 | 18 | 189 | 4.0E-22 |
| sp|Q6DHC1|RB18B_DANRE | Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 | 15 | 178 | 4.0E-22 |
| sp|P55043|RAD_RAT | GTP-binding protein RAD OS=Rattus norvegicus GN=Rrad PE=2 SV=2 | 18 | 179 | 4.0E-22 |
| sp|Q9FE79|RAA4C_ARATH | Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 | 18 | 216 | 4.0E-22 |
| sp|Q9LH50|RAA4D_ARATH | Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 | 18 | 216 | 4.0E-22 |
| sp|Q40522|RB11D_TOBAC | Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 | 18 | 204 | 4.0E-22 |
| sp|P34147|RACA_DICDI | Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 | 15 | 201 | 4.0E-22 |
| sp|Q9TVU5|RAB1_THEPA | Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 | 18 | 196 | 5.0E-22 |
| sp|Q08CX1|RASEF_XENTR | Ras and EF-hand domain-containing protein OS=Xenopus tropicalis GN=rasef PE=2 SV=1 | 16 | 180 | 6.0E-22 |
| sp|P35284|RAB12_RAT | Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 | 1 | 180 | 7.0E-22 |
| sp|P07560|SEC4_YEAST | Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 | 19 | 180 | 7.0E-22 |
| sp|P35283|RAB12_MOUSE | Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 | 1 | 180 | 8.0E-22 |
| sp|P51996|YPT32_YEAST | GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 | 18 | 203 | 8.0E-22 |
| sp|P31583|RHN1_NICPL | Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 | 19 | 188 | 8.0E-22 |
| sp|Q8BHD0|RB39A_MOUSE | Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 | 14 | 178 | 8.0E-22 |
| sp|Q54KM9|RB11B_DICDI | Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 | 19 | 178 | 9.0E-22 |
| sp|Q9CB01|RABF1_ARATH | Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 | 1 | 180 | 1.0E-21 |
| sp|P32939|YPT7_YEAST | GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 | 19 | 183 | 1.0E-21 |
| sp|Q14964|RB39A_HUMAN | Ras-related protein Rab-39A OS=Homo sapiens GN=RAB39A PE=1 SV=2 | 14 | 178 | 1.0E-21 |
| sp|Q5EB77|RAB18_RAT | Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 | 15 | 201 | 1.0E-21 |
| sp|P29687|RAB5_TOBAC | Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 | 19 | 194 | 1.0E-21 |
| sp|P55745|RAB21_CANLF | Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 | 18 | 178 | 1.0E-21 |
| sp|Q40195|RB11E_LOTJA | Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 | 18 | 178 | 1.0E-21 |
| sp|Q9SN68|RAF2B_ARATH | Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 | 19 | 190 | 1.0E-21 |
| sp|A5WW21|RASEF_DANRE | Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 | 18 | 183 | 2.0E-21 |
| sp|Q0WQN4|RAA6B_ARATH | Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 | 18 | 180 | 2.0E-21 |
| sp|Q6AXT5|RAB21_RAT | Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 | 18 | 178 | 2.0E-21 |
| sp|P36017|VPS21_YEAST | Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 | 19 | 171 | 2.0E-21 |
| sp|Q8IZ41|RASEF_HUMAN | Ras and EF-hand domain-containing protein OS=Homo sapiens GN=RASEF PE=1 SV=1 | 3 | 217 | 2.0E-21 |
| sp|Q6Z7L8|RAC7_ORYSJ | Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 | 16 | 178 | 2.0E-21 |
| sp|Q5RI75|RASEF_MOUSE | Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=1 SV=1 | 1 | 217 | 3.0E-21 |
| sp|P35293|RAB18_MOUSE | Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 | 15 | 221 | 3.0E-21 |
| sp|P36864|YPTV5_VOLCA | GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 | 16 | 190 | 3.0E-21 |
| sp|Q8WQ53|RAB21_GEOCY | Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 | 6 | 182 | 3.0E-21 |
| sp|Q4UB16|RAB1_THEAN | Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 | 18 | 190 | 4.0E-21 |
| sp|A1DZY4|RSLBL_DANRE | Ras-like protein family member 11A-like OS=Danio rerio GN=zgc:110179 PE=2 SV=1 | 16 | 180 | 4.0E-21 |
| sp|Q1KME6|RAB6A_CHICK | Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 | 15 | 171 | 4.0E-21 |
| sp|Q9LFT9|RAH1E_ARATH | Ras-related protein RABH1e OS=Arabidopsis thaliana GN=RABH1E PE=2 SV=1 | 10 | 174 | 4.0E-21 |
| sp|Q6IQ22|RAB12_HUMAN | Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 | 17 | 180 | 5.0E-21 |
| sp|P31022|RAB7_PEA | Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 | 19 | 190 | 5.0E-21 |
| sp|P61294|RAB6B_MOUSE | Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 | 15 | 171 | 6.0E-21 |
| sp|Q9NRW1|RAB6B_HUMAN | Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 | 15 | 171 | 6.0E-21 |
| sp|A6QR46|RAB6B_BOVIN | Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 | 15 | 171 | 6.0E-21 |
| sp|P11620|YPT1_SCHPO | GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 | 18 | 180 | 7.0E-21 |
| sp|Q9FGK5|RAA5A_ARATH | Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 | 18 | 217 | 7.0E-21 |
| sp|Q9C820|RAG3D_ARATH | Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 | 19 | 190 | 7.0E-21 |
| sp|O18334|RAB6_DROME | Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 | 15 | 171 | 7.0E-21 |
| sp|Q40220|RAC2_LOTJA | Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 | 16 | 178 | 8.0E-21 |
| sp|Q9WVB1|RAB6A_RAT | Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 | 15 | 171 | 8.0E-21 |
| sp|P35279|RAB6A_MOUSE | Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 | 15 | 171 | 8.0E-21 |
| sp|P31582|RAF2A_ARATH | Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 | 19 | 198 | 8.0E-21 |
| sp|P51152|RAB12_CANLF | Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 | 17 | 180 | 8.0E-21 |
| sp|Q39573|YPTC5_CHLRE | GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 | 16 | 190 | 9.0E-21 |
| sp|Q5RAV6|RAB6A_PONAB | Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 | 15 | 171 | 9.0E-21 |
| sp|P20340|RAB6A_HUMAN | Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 | 15 | 171 | 9.0E-21 |
| sp|Q40520|RB11C_TOBAC | Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 | 18 | 178 | 1.0E-20 |
| sp|Q38912|RAC3_ARATH | Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 | 16 | 178 | 1.0E-20 |
| sp|Q5R8Z8|RAB14_PONAB | Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3 | 18 | 184 | 1.0E-20 |
| sp|Q91V41|RAB14_MOUSE | Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3 | 18 | 184 | 1.0E-20 |
| sp|P61106|RAB14_HUMAN | Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 | 18 | 184 | 1.0E-20 |
| sp|Q5ZKU5|RAB14_CHICK | Ras-related protein Rab-14 OS=Gallus gallus GN=RAB14 PE=2 SV=3 | 18 | 184 | 1.0E-20 |
| sp|P61107|RAB14_RAT | Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=1 SV=3 | 18 | 184 | 1.0E-20 |
| sp|Q52NJ6|RAB14_PIG | Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3 | 18 | 184 | 1.0E-20 |
| sp|Q8BHH2|RAB9B_MOUSE | Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 | 19 | 178 | 1.0E-20 |
| sp|Q22782|RAB6B_CAEEL | Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 | 15 | 190 | 1.0E-20 |
| sp|Q9XGU0|RAC9_ARATH | Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 | 19 | 178 | 1.0E-20 |
| sp|Q9LV79|RAH1A_ARATH | Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 | 18 | 179 | 2.0E-20 |
| sp|Q99P75|RAB9A_RAT | Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 | 18 | 178 | 2.0E-20 |
| sp|Q9R0M6|RAB9A_MOUSE | Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 | 18 | 178 | 2.0E-20 |
| sp|Q41254|RAC9_GOSHI | Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 | 16 | 171 | 2.0E-20 |
| sp|Q9SID8|RAH1D_ARATH | Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 | 10 | 174 | 2.0E-20 |
| sp|Q9LW76|RAG3C_ARATH | Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 | 19 | 190 | 2.0E-20 |
| sp|P36410|RAB14_DICDI | Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 | 18 | 171 | 2.0E-20 |
| sp|P25766|RLGP1_ORYSJ | Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 | 18 | 215 | 3.0E-20 |
| sp|Q54BW4|CPAS2_DICDI | Circularly permutated Ras protein 2 OS=Dictyostelium discoideum GN=cpras2 PE=3 SV=1 | 17 | 66 | 2.0E-13 |
| sp|Q75J93|CPAS1_DICDI | Circularly permutated Ras protein 1 OS=Dictyostelium discoideum GN=cpras1 PE=3 SV=1 | 30 | 60 | 2.0E-08 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005525 | GTP binding | Yes |
| GO:0003924 | GTPase activity | Yes |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0032561 | guanyl ribonucleotide binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0019001 | guanyl nucleotide binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0043168 | anion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0003674 | molecular_function | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:0000166 | nucleotide binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 14 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 655.36 | 334.75 | 975.98 |
| Initials | Initials knots | 336.18 | 200.14 | 472.21 |
| Pileal_Stipeal_center | Stage I stipe center | 693.31 | 388.50 | 998.12 |
| Pileal_Stipeal_shell | Stage I stipe shell | 678.60 | 382.65 | 974.54 |
| DIF_stipe_center | Stage II stipe center | 854.23 | 469.85 | 1238.62 |
| DIF_stipe_shell | Stage II stipe shell | 836.76 | 458.37 | 1215.15 |
| DIF_stipe_skin | Stage II stipe skin | 709.06 | 396.11 | 1022.01 |
| DIF_cap_skin | Stage II cap skin | 767.04 | 427.03 | 1107.04 |
| DIF_cap_tissue | Stage II cap tissue | 826.37 | 456.83 | 1195.90 |
| DIF_gill_tissue | Stage II gill tissue | 771.69 | 430.53 | 1112.85 |
| YFB_stipe_center | Young fruiting body stipe center | 820.24 | 451.03 | 1189.45 |
| YFB_stipe_shell | Young fruiting body stipe shell | 864.94 | 474.86 | 1255.03 |
| YFB_stipe_skin | Young fruiting body stipe skin | 790.92 | 439.63 | 1142.20 |
| YFB_cap_skin | Young fruiting body cap skin | 802.62 | 445.42 | 1159.83 |
| YFB_cap_tissue | Young fruiting body cap tissue | 984.50 | 530.08 | 1438.93 |
| YFB_gill_tissue | Young fruiting body gill tissue | 736.14 | 411.07 | 1061.20 |
| YFB_veil | Young fruiting body veil | 822.70 | 452.37 | 1193.03 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.725815 | no |
| Casing | YFB_stipe_center | 0.607221 | no |
| Casing | YFB_stipe_shell | 0.482998 | no |
| Casing | YFB_stipe_skin | 0.672114 | no |
| Casing | YFB_cap_skin | 0.638874 | no |
| Casing | YFB_cap_tissue | 0.245982 | no |
| Casing | YFB_gill_tissue | 0.827672 | no |
| Casing | YFB_veil | 0.594542 | no |
| Casing | Initials | 0.017226 | yes |
| Casing | Pileal_Stipeal_center | 0.925955 | no |
| Casing | Pileal_Stipeal_shell | 0.955317 | no |
| Casing | DIF_stipe_center | 0.509720 | no |
| Casing | DIF_stipe_shell | 0.555787 | no |
| Casing | DIF_stipe_skin | 0.889676 | no |
| Casing | DIF_cap_skin | 0.740039 | no |
| Casing | DIF_cap_tissue | 0.572164 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.914616 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.823034 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.966507 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.947647 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.544237 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.936701 | no |
| DIF_gill_tissue | YFB_veil | 0.909976 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.929599 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.950227 | no |
| YFB_stipe_center | YFB_cap_skin | 0.971408 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.688260 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.837538 | no |
| YFB_stipe_center | YFB_veil | 0.995145 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.868950 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.894431 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.797581 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.730008 | no |
| YFB_stipe_shell | YFB_veil | 0.935181 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.980127 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.595483 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.897120 | no |
| YFB_stipe_skin | YFB_veil | 0.947685 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.634140 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.872760 | no |
| YFB_cap_skin | YFB_veil | 0.967573 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.446558 | no |
| YFB_cap_tissue | YFB_veil | 0.694970 | no |
| YFB_gill_tissue | YFB_veil | 0.828610 | no |
| Initials | DIF_gill_tissue | 0.003365 | yes |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.001140 | yes |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.004160 | yes |
| Initials | YFB_veil | 0.001140 | yes |
| Initials | Pileal_Stipeal_center | 0.009773 | yes |
| Initials | Pileal_Stipeal_shell | 0.004928 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.001625 | yes |
| Initials | DIF_stipe_skin | 0.006032 | yes |
| Initials | DIF_cap_skin | 0.002084 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.833146 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.717566 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.594743 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.785355 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.751241 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.327476 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.917520 | no |
| Pileal_Stipeal_center | YFB_veil | 0.707008 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.970741 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.623771 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.668752 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.970020 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.846570 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.688936 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.783711 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.661626 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.531182 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.732490 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.695734 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.269957 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.879025 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.649543 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.560248 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.608401 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.937929 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.798072 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.629077 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.845902 | no |
| DIF_stipe_center | YFB_stipe_center | 0.947284 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.983795 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.889125 | no |
| DIF_stipe_center | YFB_cap_skin | 0.912629 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.773565 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.755328 | no |
| DIF_stipe_center | YFB_veil | 0.951146 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.972826 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.674277 | no |
| DIF_stipe_center | DIF_cap_skin | 0.836005 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.955815 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.883138 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.974839 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.958803 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.923050 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.945690 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.732771 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.800311 | no |
| DIF_stipe_shell | YFB_veil | 0.978073 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.719533 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.875284 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.983404 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.873104 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.762563 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.641301 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.828997 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.796153 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.365647 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.950720 | no |
| DIF_stipe_skin | YFB_veil | 0.754323 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.885026 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.737486 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.991476 | no |
| DIF_cap_skin | YFB_stipe_center | 0.904596 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.810984 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.958682 | no |
| DIF_cap_skin | YFB_cap_skin | 0.938332 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.524882 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.945690 | no |
| DIF_cap_skin | YFB_veil | 0.900094 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.889779 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.901103 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.989611 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.940225 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.939180 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.961401 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.694593 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.819146 | no |
| DIF_cap_tissue | YFB_veil | 0.992693 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|083670 MANNAASRAAQAQFLREYKLVVVGGGGVGKSALTIQFIKSHFVDEYDPTIEDSYRKQCVIDEEVALLDVLDTAGQ EEYGAMREQYMRTGEGFLLVYSITARSSFEEINQFYQQILRVKDQDSFPVIVVANKCDLEYERQVGMNEGRDLAR HFGCKFIETSAKQRINVDEAFSNLVREIRKYNKDQQTGRPLHGSGGGAGGYGGKDHNDDGGAGCCGGCVIL* |
| Coding | >AgabiH97|083670 ATGGCAAACAACGCTGCGTCCAGAGCTGCTCAGGCCCAGTTCCTGAGAGAATACAAGCTCGTAGTGGTCGGAGGA GGAGGTGTTGGAAAGTCTGCATTGACTATCCAATTCATTAAAAGCCATTTCGTGGACGAGTACGACCCAACTATT GAGGACTCGTACAGGAAACAATGCGTCATTGATGAAGAGGTCGCCCTTCTCGATGTCCTGGATACTGCTGGTCAA GAAGAATATGGTGCCATGCGGGAGCAATACATGCGTACTGGGGAGGGATTTCTTCTCGTCTACAGCATCACCGCG CGTAGCTCCTTTGAAGAAATCAACCAGTTTTACCAGCAAATTTTGAGGGTCAAAGATCAAGATTCTTTCCCTGTT ATTGTCGTTGCAAACAAGTGCGATTTGGAATATGAACGCCAAGTTGGTATGAACGAGGGCCGAGATCTCGCGAGA CACTTTGGCTGCAAATTCATCGAGACGTCTGCCAAACAACGAATAAACGTGGATGAAGCTTTCAGCAATCTTGTT CGTGAAATCCGAAAATATAACAAGGACCAACAAACAGGCCGCCCTCTCCACGGCAGCGGTGGTGGAGCCGGCGGT TATGGTGGCAAGGACCACAATGACGATGGAGGTGCTGGCTGCTGCGGCGGTTGCGTTATTCTTTAA |
| Transcript | >AgabiH97|083670 ATGGCAAACAACGCTGCGTCCAGAGCTGCTCAGGCCCAGTTCCTGAGAGAATACAAGCTCGTAGTGGTCGGAGGA GGAGGTGTTGGAAAGTCTGCATTGACTATCCAATTCATTAAAAGCCATTTCGTGGACGAGTACGACCCAACTATT GAGGACTCGTACAGGAAACAATGCGTCATTGATGAAGAGGTCGCCCTTCTCGATGTCCTGGATACTGCTGGTCAA GAAGAATATGGTGCCATGCGGGAGCAATACATGCGTACTGGGGAGGGATTTCTTCTCGTCTACAGCATCACCGCG CGTAGCTCCTTTGAAGAAATCAACCAGTTTTACCAGCAAATTTTGAGGGTCAAAGATCAAGATTCTTTCCCTGTT ATTGTCGTTGCAAACAAGTGCGATTTGGAATATGAACGCCAAGTTGGTATGAACGAGGGCCGAGATCTCGCGAGA CACTTTGGCTGCAAATTCATCGAGACGTCTGCCAAACAACGAATAAACGTGGATGAAGCTTTCAGCAATCTTGTT CGTGAAATCCGAAAATATAACAAGGACCAACAAACAGGCCGCCCTCTCCACGGCAGCGGTGGTGGAGCCGGCGGT TATGGTGGCAAGGACCACAATGACGATGGAGGTGCTGGCTGCTGCGGCGGTTGCGTTATTCTTTAA |
| Gene | >AgabiH97|083670 ATGGCAAACAACGCTGCGTCCAGAGTATGTCCTCCCCACAAACCGCCCTCAGTTTCTTGGCTTATGCTCTATTTC AGGCTGCTCAGGCCCAGTTCCTGAGAGAATACAAGCTCGTAGTGGTCGGAGGAGGAGGCAAGTGCTACCCGCCCT TACAAGCTAGCAAGTCCTAAAGTCGTGTACAGGTGTTGGAAAGTCTGCATTGACTATCCAATTCATTAAAAGCCA TTTCGTGGACGAGTACGACCCAACTATTGAGGGTGAGCTTCTTTCTCACCAATCAATCCCCCTCCAGGTTATGAC ATTTCGGAACATTTGTGCTAACATTCTCGTCTTAAAACAGACTCGTACAGGAAACAATGCGTCATTGATGAAGAG GTCGCCCTTCTCGATGTCCTGGATACTGCTGGTCAAGAAGAATATGGGTCAGTGTGCTCTCCTGAATAAATTCCG AAGCAGTCCCCGATTTTTTTTCCTTTCGTCTCGTGATTCGACTATGAAAATGGTCTTCCACGAGGCGAAGCTTTC ATTTCCCGGCATAATTCAGTTATACGACCCTGGATCTAACCCTATATGTACTTATTTTCCAGTGCCATGCGGGAG CAATACATGCGTACTGGGGAGGGATTTCTTCTCGTCTACAGCATCACCGCGCGTAGCTCCTTTGAAGAAATCAAC CAGTTTTACCAGCAAATTTTGAGGGTCAAAGATCAAGATTCTTTCCCTGTTATTGTCGTTGCAAACAAGTGCGAT TTGGAATATGAACGCCAAGTTGGTATGAACGGTATGTTGTTAAACCTTGGAGTATATCAGGGCCCAGTAGTGACG CAACCTACAGAGGGCCGAGATCTCGCGAGACACTTTGGCTGCAAATTCATCGAGACGTCTGCCAAACAACGAATA AACGTGGATGAAGCTTTCAGCAATCTTGTTCGTGAAATCCGAAAATATAACAAGGTCGGTTTTCCACATCACACG CAGATTTTACAAACTCATTGGTACTTTTATAGGACCAACAAACAGGCCGCCCTCTCCACGGCAGCGGTGGTGGAG CCGGCGGTTATGGTGGCAAGGACCACAATGACGATGGAGGTGCTGGCTGCTGCGGCGGTTGCGTTATTCTTTAA |