Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|083630
Gene name
Locationscaffold_5:1358699..1359941
Strand-
Gene length (bp)1242
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19086 Terpene_syn_C_2 Terpene synthase family 2, C-terminal metal binding 9.7E-42 77 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8NU13|COP4_COPC7 Linoleate 10R-lipoxygenase COP4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP4 PE=1 SV=1 2 331 3.0E-154
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 4 318 7.0E-50
sp|P0DL13|PRO1_ARMGA Delta(6)-protoilludene synthase OS=Armillaria gallica GN=PRO1 PE=1 SV=1 5 333 1.0E-43
sp|B5GS26|DCADS_STRC2 (-)-delta-cadinene synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=SCreLAV_p0328 PE=1 SV=1 13 308 7.0E-19
sp|B2J4A4|GERAS_NOSP7 Germacrene A synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R3832 PE=1 SV=1 6 316 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8NU13|COP4_COPC7 Linoleate 10R-lipoxygenase COP4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP4 PE=1 SV=1 2 331 3.0E-154
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 4 318 7.0E-50
sp|P0DL13|PRO1_ARMGA Delta(6)-protoilludene synthase OS=Armillaria gallica GN=PRO1 PE=1 SV=1 5 333 1.0E-43
sp|B5GS26|DCADS_STRC2 (-)-delta-cadinene synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=SCreLAV_p0328 PE=1 SV=1 13 308 7.0E-19
sp|B2J4A4|GERAS_NOSP7 Germacrene A synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R3832 PE=1 SV=1 6 316 7.0E-18
sp|D8RLD3|MTS17_SELML (+)-germacrene D synthase OS=Selaginella moellendorffii GN=SELMODRAFT_412756 PE=1 SV=1 22 310 2.0E-15
sp|J9R393|MTS13_SELML Microbial Terpene synthase-like protein 13 OS=Selaginella moellendorffii GN=SELMODRAFT_412537 PE=2 SV=2 72 310 2.0E-15
sp|Q6WP50|BOT2_BOTFU Presilphiperfolan-8-beta-ol synthase OS=Botryotinia fuckeliana GN=BOT2 PE=1 SV=1 3 327 6.0E-15
sp|J9R1J8|MTS1_SELML Microbial Terpene synthase-like protein 1 OS=Selaginella moellendorffii GN=SELMODRAFT_402353 PE=1 SV=2 21 310 7.0E-15
sp|Q9K499|CYC1_STRCO Epi-isozizaene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyc1 PE=1 SV=1 4 312 1.0E-11
sp|B1W019|GCOA_STRGG (+)-caryolan-1-ol synthase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gcoA PE=1 SV=1 48 259 1.0E-10
sp|A1C8C3|OPHFS_ASPCL Ophiobolin F synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_076850 PE=1 SV=1 124 310 6.0E-10
sp|J9QS25|MTS26_SELML (E)-2-epi-beta-caryophyllene synthase OS=Selaginella moellendorffii GN=SELMODRAFT_414574 PE=1 SV=2 6 310 8.0E-10
sp|A2PZA5|FUSS_PHOAM Fusicoccadiene synthase OS=Phomopsis amygdali GN=PaFS PE=1 SV=1 166 308 8.0E-08
sp|D8RNZ9|MTS22_SELML (3S,6E)-nerolidol synthase OS=Selaginella moellendorffii GN=SELMODRAFT_413294 PE=1 SV=1 6 311 2.0E-07
sp|Q82RR7|TPC1_STRAW Avermitilol synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tpc1 PE=1 SV=1 156 313 3.0E-06
sp|C9K2Q3|FUSS_ALTBR Fusicoccadiene synthase OS=Alternaria brassicicola GN=bsc8 PE=1 SV=1 155 308 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|083630
MPRPQQFILPDLLSSCPLEDGLNPHYREAAAESRTWINSFNIFSNRKRADFIQGLNELLCSHVYCYAGYEEFRTT
CDFVNVLFVVDEISDEQSGKDARATGLSYAESMRNADWDDNSVVAKITKEFRARLIRRAGHNNFRRFVASSDAYT
RCVGREAELREAGEVLSLEEYIPLRRNNSAVLLCFDLVEYILGVDLPESIYQNATFLKAYWAACDHVCWCNDVYS
YNVEQSKGHTGNNVVTVLMNDRQIGLQEACDYIGDRCRQFMNDYLAARDELRATVGGDASRFIDALGYWIIGNME
WSFESPRYFGHEHDEIKRTLTLTLKPSEVPEEVDSDSDCE*
Coding >AgabiH97|083630
ATGCCTCGCCCTCAACAATTCATTCTCCCAGACTTGCTCTCTAGTTGTCCTCTCGAGGATGGTTTGAATCCCCAC
TACCGAGAAGCAGCCGCAGAGTCTCGTACCTGGATCAACTCTTTCAATATTTTCTCCAACCGAAAACGCGCCGAC
TTTATCCAAGGTCTTAACGAGCTCCTTTGCTCTCACGTATATTGCTACGCTGGATACGAAGAATTCAGAACTACA
TGCGACTTTGTTAACGTGTTGTTCGTCGTTGATGAGATCAGCGATGAGCAAAGTGGCAAAGATGCTAGAGCGACC
GGCTTGAGCTATGCTGAATCTATGAGAAATGCCGACTGGGACGACAATTCCGTAGTTGCTAAGATCACGAAAGAG
TTTCGTGCGCGTCTTATCCGACGGGCTGGACATAATAATTTTCGTCGCTTTGTCGCATCTTCTGACGCGTACACA
CGATGTGTAGGCAGAGAAGCCGAGCTCCGAGAGGCAGGAGAGGTACTATCGTTGGAGGAGTACATCCCCCTTCGA
CGGAATAATAGCGCCGTCTTGTTATGCTTCGATTTGGTGGAGTATATCCTCGGGGTTGACCTCCCTGAGAGTATA
TATCAAAACGCTACCTTCTTGAAGGCATATTGGGCAGCGTGTGACCACGTCTGCTGGTGTAACGATGTCTACTCA
TATAACGTGGAGCAATCAAAGGGACACACCGGCAACAACGTCGTTACCGTTCTCATGAATGACCGTCAAATCGGA
CTCCAGGAGGCATGCGACTACATCGGTGACCGTTGCCGGCAATTTATGAATGATTATCTTGCCGCGCGGGATGAG
CTCCGAGCGACTGTTGGCGGTGACGCTTCACGGTTCATCGATGCTCTAGGTTATTGGATAATTGGTAACATGGAG
TGGAGCTTCGAATCTCCTCGTTACTTTGGCCATGAACATGACGAGATCAAACGCACCCTGACTCTGACTTTGAAA
CCCAGCGAGGTGCCCGAGGAGGTAGACTCAGATTCAGATTGCGAGTGA
Transcript >AgabiH97|083630
ATGCCTCGCCCTCAACAATTCATTCTCCCAGACTTGCTCTCTAGTTGTCCTCTCGAGGATGGTTTGAATCCCCAC
TACCGAGAAGCAGCCGCAGAGTCTCGTACCTGGATCAACTCTTTCAATATTTTCTCCAACCGAAAACGCGCCGAC
TTTATCCAAGGTCTTAACGAGCTCCTTTGCTCTCACGTATATTGCTACGCTGGATACGAAGAATTCAGAACTACA
TGCGACTTTGTTAACGTGTTGTTCGTCGTTGATGAGATCAGCGATGAGCAAAGTGGCAAAGATGCTAGAGCGACC
GGCTTGAGCTATGCTGAATCTATGAGAAATGCCGACTGGGACGACAATTCCGTAGTTGCTAAGATCACGAAAGAG
TTTCGTGCGCGTCTTATCCGACGGGCTGGACATAATAATTTTCGTCGCTTTGTCGCATCTTCTGACGCGTACACA
CGATGTGTAGGCAGAGAAGCCGAGCTCCGAGAGGCAGGAGAGGTACTATCGTTGGAGGAGTACATCCCCCTTCGA
CGGAATAATAGCGCCGTCTTGTTATGCTTCGATTTGGTGGAGTATATCCTCGGGGTTGACCTCCCTGAGAGTATA
TATCAAAACGCTACCTTCTTGAAGGCATATTGGGCAGCGTGTGACCACGTCTGCTGGTGTAACGATGTCTACTCA
TATAACGTGGAGCAATCAAAGGGACACACCGGCAACAACGTCGTTACCGTTCTCATGAATGACCGTCAAATCGGA
CTCCAGGAGGCATGCGACTACATCGGTGACCGTTGCCGGCAATTTATGAATGATTATCTTGCCGCGCGGGATGAG
CTCCGAGCGACTGTTGGCGGTGACGCTTCACGGTTCATCGATGCTCTAGGTTATTGGATAATTGGTAACATGGAG
TGGAGCTTCGAATCTCCTCGTTACTTTGGCCATGAACATGACGAGATCAAACGCACCCTGACTCTGACTTTGAAA
CCCAGCGAGGTGCCCGAGGAGGTAGACTCAGATTCAGATTGCGAGTGA
Gene >AgabiH97|083630
ATGCCTCGCCCTCAACAATTCATTCTCCCAGACTTGCTCTCTAGTTGTCCTCTCGAGGATGGTTTGAATCCCCAC
TACCGAGAAGCAGCCGCAGAGTCTCGTACCTGGATCAACTCTTTCAATATTTTCTCCAACCGAAAACGCGCCGAC
TTTATCCAAGGTCTTAACGAGCTCCTTTGCTCTCACGTATATTGCTACGCTGGATACGAAGAATTCAGAACTACA
TGCGACTTTGTAAGCTCAAACTTCAAGTTCCTGTTGATATAGCAGCTGATCATAGTATCTTGTCCAGGTTAACGT
GTTGTTCGTCGTTGATGAGATCAGCGATGAGCAAAGTGGCAAAGATGCTAGAGCGACCGGCTTGAGCTATGCTGA
ATCTATGAGAAATGCCGACTGGGACGACAATTCCGTAGTTGCTAAGATCACGAAAGAGTGAGTATATCAAACTAT
TCTCTGATCGTCAGAAATTGACAATTACCAAGGTTTCGTGCGCGTCTTATCCGACGGGCTGGACATAATAATTTT
CGTCGCTTTGTCGCATCTTCTGACGCGTACACACGATGTGTAGGCAGAGAAGCCGAGCTCCGAGAGGCAGGAGAG
GTACTATCGTTGGAGGAGTACATCCCCCTTCGACGGAATAATAGCGCCGTCTTGTTATGCTTCGATTTGGTGGAG
TATATCCTCGGGGTTGACCTCCCTGAGAGTATATATCAAAACGCTACCTTCTTGAAGGCATATTGGGCAGCGTGT
GACCACGTCTGCTGGTGTAACGTGAGTGTGCAGGTCGCTAGCTGATACGAATACCAACTTACAATCTTTCTCAGG
ATGTCTACTCATATAACGTGGAGCAATCAAAGGGACACACCGGCAACAACGTCGTTACCGTTCTCATGAATGACC
GTCAAATCGGACTCCAGGAGGCATGCGACTACATCGGTGACCGTTGCCGGCAATTTATGAATGATTATCTTGCCG
CGCGGGATGAGCTCCGAGCGACTGTTGGCGGTGACGCTTCACGGTTCATCGATGCTCTAGGTTATTGGATAATTG
GTAACATGGAGTACGTTAGTTTTCGCTCTCACCAACTTTTTAAAGTCACTTACGAAATTCTTCTTCAGGTGGAGC
TTCGAATCTCCTCGTTACTTTGGCCATGAACATGACGAGATCAAACGCACCCTGACTCTGACTTTGAAACCCAGC
GAGGTGCCCGAGGAGGTAGACTCAGATTCAGATTGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail