Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|083540
Gene name
Locationscaffold_5:1330744..1332559
Strand-
Gene length (bp)1815
Transcript length (bp)1479
Coding sequence length (bp)1479
Protein length (aa) 493

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16275 SF1-HH Splicing factor 1 helix-hairpin domain 9.2E-39 79 186
PF00098 zf-CCHC Zinc knuckle 1.3E-04 317 333
PF00098 zf-CCHC Zinc knuckle 1.2E-05 342 357
PF00013 KH_1 KH domain 5.1E-05 209 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO45|BBP_CRYNB Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BBP PE=3 SV=1 58 470 5.0E-174
sp|P0CO44|BBP_CRYNJ Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BBP PE=3 SV=1 58 470 5.0E-174
sp|Q4P0H7|BBP_USTMA Branchpoint-bridging protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BBP PE=3 SV=1 46 429 1.0E-155
sp|Q8NIW7|BBP_NEUCR Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bbp-1 PE=3 SV=1 2 422 5.0E-137
sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 2 356 1.0E-134
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO45|BBP_CRYNB Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BBP PE=3 SV=1 58 470 5.0E-174
sp|P0CO44|BBP_CRYNJ Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BBP PE=3 SV=1 58 470 5.0E-174
sp|Q4P0H7|BBP_USTMA Branchpoint-bridging protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BBP PE=3 SV=1 46 429 1.0E-155
sp|Q8NIW7|BBP_NEUCR Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bbp-1 PE=3 SV=1 2 422 5.0E-137
sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 2 356 1.0E-134
sp|O74555|BBP_SCHPO Branchpoint-bridging protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpb1 PE=1 SV=1 10 435 1.0E-119
sp|Q6C187|BBP_YARLI Branchpoint-bridging protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BBP PE=3 SV=1 10 391 5.0E-102
sp|Q12186|BBP_YEAST Branchpoint-bridging protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSL5 PE=1 SV=1 70 356 7.0E-87
sp|Q15637|SF01_HUMAN Splicing factor 1 OS=Homo sapiens GN=SF1 PE=1 SV=4 71 390 4.0E-78
sp|Q64213|SF01_MOUSE Splicing factor 1 OS=Mus musculus GN=Sf1 PE=1 SV=6 77 405 1.0E-77
sp|Q750X2|BBP_ASHGO Branchpoint-bridging protein OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BBP PE=3 SV=2 100 357 2.0E-77
sp|Q6FW77|BBP_CANGA Branchpoint-bridging protein OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BBP PE=3 SV=1 93 357 4.0E-77
sp|Q5AED9|BBP_CANAL Branchpoint-bridging protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BBP PE=3 SV=1 65 368 2.0E-64
sp|Q6BSP4|BBP_DEBHA Branchpoint-bridging protein OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BBP PE=3 SV=2 96 356 3.0E-58
sp|Q54BM5|BBP_DICDI Branchpoint-bridging protein OS=Dictyostelium discoideum GN=sf1 PE=3 SV=1 45 390 5.0E-57
sp|Q32NN2|QKIA_XENLA Protein quaking-A OS=Xenopus laevis GN=qki-a PE=1 SV=2 132 312 3.0E-20
sp|Q91XU1|QKI_RAT Protein quaking OS=Rattus norvegicus GN=Qki PE=1 SV=2 132 312 8.0E-20
sp|Q5W9D5|QKI_PIG Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1 132 312 8.0E-20
sp|Q9QYS9|QKI_MOUSE Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1 132 312 8.0E-20
sp|Q96PU8|QKI_HUMAN Protein quaking OS=Homo sapiens GN=QKI PE=1 SV=1 132 312 8.0E-20
sp|Q5W9D6|QKI_HORSE Protein quaking OS=Equus caballus GN=QKI PE=2 SV=1 132 312 8.0E-20
sp|Q7JJZ8|QKI_FELCA Protein quaking OS=Felis catus GN=QKI PE=2 SV=1 132 312 8.0E-20
sp|Q9GMY1|QKI_CANLF Protein quaking OS=Canis lupus familiaris GN=QKI PE=2 SV=1 132 312 8.0E-20
sp|Q5W9D7|QKI_BOVIN Protein quaking OS=Bos taurus GN=QKI PE=2 SV=1 132 312 8.0E-20
sp|Q6P104|QKIB_DANRE Protein quaking-B OS=Danio rerio GN=qkib PE=2 SV=1 132 312 1.0E-19
sp|Q9YH18|QKI_CHICK Protein quaking OS=Gallus gallus GN=QKI PE=2 SV=2 157 312 2.0E-19
sp|Q6IRN2|QKIB_XENLA Protein quaking-B OS=Xenopus laevis GN=qki-b PE=1 SV=1 196 312 3.0E-19
sp|O01367|HOW_DROME Protein held out wings OS=Drosophila melanogaster GN=how PE=1 SV=1 195 340 2.0E-18
sp|Q17339|GLD1_CAEEL Female germline-specific tumor suppressor gld-1 OS=Caenorhabditis elegans GN=gld-1 PE=1 SV=1 195 311 2.0E-18
sp|Q6P0D0|QKIA_DANRE Protein quaking-A OS=Danio rerio GN=qkia PE=2 SV=2 145 312 5.0E-18
sp|Q75GR5|SPIN1_ORYSJ KH domain-containing protein SPIN1 OS=Oryza sativa subsp. japonica GN=SPIN1 PE=1 SV=1 197 313 6.0E-18
sp|Q9FKT4|QKIL2_ARATH KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1 197 313 2.0E-17
sp|Q8GYR4|QKIL4_ARATH KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1 197 313 4.0E-17
sp|Q0WLR1|QKIL1_ARATH KH domain-containing protein At4g26480 OS=Arabidopsis thaliana GN=At4g26480 PE=2 SV=1 197 313 1.0E-16
sp|Q5VWX1|KHDR2_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens GN=KHDRBS2 PE=1 SV=1 195 309 2.0E-16
sp|Q9ZVI3|QKIL3_ARATH KH domain-containing protein At2g38610 OS=Arabidopsis thaliana GN=At2g38610 PE=1 SV=1 197 313 3.0E-16
sp|Q920F3|KHDR2_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Rattus norvegicus GN=Khdrbs2 PE=1 SV=1 195 309 3.0E-16
sp|Q0VFL3|KHDR2_XENTR KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Xenopus tropicalis GN=khdrbs2 PE=2 SV=1 195 309 6.0E-16
sp|Q9WU01|KHDR2_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Mus musculus GN=Khdrbs2 PE=1 SV=1 195 309 7.0E-16
sp|Q08BJ2|KHDR2_DANRE KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Danio rerio GN=khdrbs2 PE=2 SV=1 195 309 2.0E-15
sp|Q8GWR3|QKIL5_ARATH KH domain-containing protein At1g09660/At1g09670 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1 197 313 3.0E-15
sp|Q9R226|KHDR3_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Mus musculus GN=Khdrbs3 PE=1 SV=1 190 308 5.0E-14
sp|O75525|KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens GN=KHDRBS3 PE=1 SV=1 190 308 5.0E-14
sp|Q9JLP1|KHDR3_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Rattus norvegicus GN=Khdrbs3 PE=1 SV=1 190 308 7.0E-14
sp|Q8UUW7|KHDR1_CHICK KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Gallus gallus GN=KHDRBS1 PE=2 SV=1 190 309 4.0E-11
sp|Q07666|KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1 190 309 5.0E-11
sp|Q91V33|KHDR1_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus GN=Khdrbs1 PE=1 SV=1 190 309 6.0E-11
sp|Q60749|KHDR1_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Mus musculus GN=Khdrbs1 PE=1 SV=2 190 309 6.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0003723 RNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|083540
MWRPATKQITGTNDVPLGQRRRFGPAPAEDTAPPQLAQPSPSVYPRHRDQDTDSPGKRGREESPNRGDPKVDPNA
PRKRRSRWGEAKTEIPGLPTAISAAGVSQVQLDNYAIHLRLEEINRKLRLNDFVPPERERSPSPPPTYDAHGRRT
NTREVRYRKKLEDERIRLVDRAMKNDPNFRPPVEYHQQKRSQRPSEKVYIPVKEFPEINFFGLLVGPRGNSLKKM
ERDSGAKISIRGKGSVKEGKARPDQFAEDAEEDLHCLVIADSDDKVAACVKMINRVIETAASTPEGQNVHKRDQL
RELAALNGTLRDDENQICQNCGGIGHRKYDCPEQRNFTANIICHVCGSAGHMARDCTVNKDPNAPPRPQQQMRGG
FDSEYASLMAELGEGATGGGEGGKTWGGTSMGHDITAGGSNIPPWRRPENWQQPAAAQQSQGYRPPQGYGAGYSG
AGYGGAGGNAYPGYQQAGYQQPQDYSNYAAYYQGQYAQQQPS*
Coding >AgabiH97|083540
ATGTGGAGACCTGCAACCAAGCAGATAACTGGCACCAACGACGTTCCCCTTGGTCAACGTCGTCGTTTTGGGCCT
GCGCCTGCAGAGGACACTGCGCCGCCGCAGCTCGCGCAGCCTTCCCCTTCCGTGTACCCTCGTCACCGTGATCAG
GACACTGATAGCCCTGGAAAACGCGGGCGAGAAGAATCGCCCAACAGAGGAGATCCGAAAGTTGATCCCAATGCT
CCCCGCAAACGACGCAGTCGATGGGGTGAAGCAAAAACTGAAATACCCGGTCTACCAACCGCTATCTCTGCCGCT
GGAGTATCCCAAGTCCAACTCGATAACTATGCGATCCACCTACGTTTAGAAGAGATTAATCGGAAGCTTCGGCTC
AATGATTTTGTACCTCCAGAGCGTGAAAGATCCCCATCCCCTCCTCCAACCTATGATGCCCATGGTCGCAGGACC
AATACTCGTGAAGTCCGCTACCGCAAAAAACTCGAAGATGAACGCATAAGGCTTGTGGACCGTGCAATGAAGAAT
GACCCCAACTTTCGCCCGCCCGTTGAATATCATCAACAAAAACGATCTCAGAGGCCTTCTGAAAAGGTCTACATC
CCAGTTAAAGAGTTTCCAGAGATCAACTTCTTTGGTTTATTAGTCGGTCCTCGTGGCAATAGTTTGAAGAAGATG
GAACGCGACAGCGGTGCTAAAATTAGTATCCGTGGCAAAGGCAGCGTCAAAGAAGGGAAAGCTCGACCTGATCAA
TTTGCTGAGGATGCAGAAGAAGATCTACATTGTCTTGTCATTGCTGACTCTGACGACAAGGTAGCCGCTTGCGTC
AAAATGATCAACCGAGTCATAGAGACAGCGGCTTCTACTCCGGAAGGTCAAAATGTTCATAAACGTGATCAACTT
CGAGAGCTCGCTGCTTTGAACGGTACTCTGCGTGACGATGAAAACCAGATTTGTCAAAATTGTGGTGGCATAGGA
CATCGCAAATATGATTGTCCAGAGCAACGCAACTTTACTGCTAACATAATCTGTCATGTTTGTGGTAGTGCTGGT
CATATGGCGAGGGATTGTACCGTCAACAAAGATCCTAATGCGCCGCCCCGCCCGCAGCAACAAATGAGAGGGGGT
TTCGATTCTGAATACGCAAGTCTGATGGCCGAGTTAGGTGAAGGTGCAACTGGCGGCGGGGAAGGAGGAAAAACA
TGGGGTGGTACTAGTATGGGTCACGACATAACAGCAGGCGGTTCTAACATCCCCCCCTGGCGTCGCCCCGAAAAC
TGGCAGCAACCTGCCGCTGCGCAGCAATCACAAGGTTACCGACCTCCTCAAGGTTACGGAGCCGGTTACTCAGGT
GCTGGCTATGGTGGCGCTGGAGGAAATGCGTATCCCGGTTACCAGCAAGCTGGTTATCAACAGCCTCAAGACTAC
TCTAATTATGCCGCTTACTATCAAGGCCAATACGCTCAACAACAACCCAGCTGA
Transcript >AgabiH97|083540
ATGTGGAGACCTGCAACCAAGCAGATAACTGGCACCAACGACGTTCCCCTTGGTCAACGTCGTCGTTTTGGGCCT
GCGCCTGCAGAGGACACTGCGCCGCCGCAGCTCGCGCAGCCTTCCCCTTCCGTGTACCCTCGTCACCGTGATCAG
GACACTGATAGCCCTGGAAAACGCGGGCGAGAAGAATCGCCCAACAGAGGAGATCCGAAAGTTGATCCCAATGCT
CCCCGCAAACGACGCAGTCGATGGGGTGAAGCAAAAACTGAAATACCCGGTCTACCAACCGCTATCTCTGCCGCT
GGAGTATCCCAAGTCCAACTCGATAACTATGCGATCCACCTACGTTTAGAAGAGATTAATCGGAAGCTTCGGCTC
AATGATTTTGTACCTCCAGAGCGTGAAAGATCCCCATCCCCTCCTCCAACCTATGATGCCCATGGTCGCAGGACC
AATACTCGTGAAGTCCGCTACCGCAAAAAACTCGAAGATGAACGCATAAGGCTTGTGGACCGTGCAATGAAGAAT
GACCCCAACTTTCGCCCGCCCGTTGAATATCATCAACAAAAACGATCTCAGAGGCCTTCTGAAAAGGTCTACATC
CCAGTTAAAGAGTTTCCAGAGATCAACTTCTTTGGTTTATTAGTCGGTCCTCGTGGCAATAGTTTGAAGAAGATG
GAACGCGACAGCGGTGCTAAAATTAGTATCCGTGGCAAAGGCAGCGTCAAAGAAGGGAAAGCTCGACCTGATCAA
TTTGCTGAGGATGCAGAAGAAGATCTACATTGTCTTGTCATTGCTGACTCTGACGACAAGGTAGCCGCTTGCGTC
AAAATGATCAACCGAGTCATAGAGACAGCGGCTTCTACTCCGGAAGGTCAAAATGTTCATAAACGTGATCAACTT
CGAGAGCTCGCTGCTTTGAACGGTACTCTGCGTGACGATGAAAACCAGATTTGTCAAAATTGTGGTGGCATAGGA
CATCGCAAATATGATTGTCCAGAGCAACGCAACTTTACTGCTAACATAATCTGTCATGTTTGTGGTAGTGCTGGT
CATATGGCGAGGGATTGTACCGTCAACAAAGATCCTAATGCGCCGCCCCGCCCGCAGCAACAAATGAGAGGGGGT
TTCGATTCTGAATACGCAAGTCTGATGGCCGAGTTAGGTGAAGGTGCAACTGGCGGCGGGGAAGGAGGAAAAACA
TGGGGTGGTACTAGTATGGGTCACGACATAACAGCAGGCGGTTCTAACATCCCCCCCTGGCGTCGCCCCGAAAAC
TGGCAGCAACCTGCCGCTGCGCAGCAATCACAAGGTTACCGACCTCCTCAAGGTTACGGAGCCGGTTACTCAGGT
GCTGGCTATGGTGGCGCTGGAGGAAATGCGTATCCCGGTTACCAGCAAGCTGGTTATCAACAGCCTCAAGACTAC
TCTAATTATGCCGCTTACTATCAAGGCCAATACGCTCAACAACAACCCAGCTGA
Gene >AgabiH97|083540
ATGTGGAGACCTGCAACCAAGCAGATAACTGGCACCAACGACGGTATGCTCAACAAAATTCTTTCTCTTCTCCCA
GTTGTCTCATACTTTTTTTTCAGTTCCCCTTGGTCAACGTCGTCGTTTTGGGCCTGCGCCTGCAGAGGACACTGC
GCCGCCGCAGCTCGCGCAGCCTTCCCCTTCCGTGTACCCTCGTCACCGTGATCAGGACACTGATAGCCCTGGAAA
ACGCGGGCGAGAAGAATCGCCCAACAGAGGAGATCCGAAAGGTAAGTCAGCGACTGATCAGCTCTCTCGTGTTTG
CCGGCAAGCTGTTCTGCTCCACGCTATCTCAGCGAACTGACGTGGCCGCCTGAAGTCATGGACACAAGGAGCATC
TAAGTAACACTGAGGATGTACTAACCTTGACCCTGTTGCTGTTTCTCACTTTTACTAGTTGATCCCAATGCTCCC
CGCAAACGACGCAGTCGATGGGGTGAAGCAAAAACTGAAATACCCGGTCTACCAACCGCTATCTCTGCCGCTGGA
GTATCCCAAGTCCAACTCGATAACTATGCGATCCACCTACGTTTAGAAGAGATTAATCGGAAGCTTCGGCTCAAT
GATTTTGTACCTCCAGAGCGTGAAAGGTAGTGTCATTCTGCGTACTTCCTTAGCCTACCGCATATATTAAGATAT
TGCTTGTCCAGATCCCCATCCCCTCCTCCAACCTATGATGCCCATGGTCGCAGGACCAATACTCGTGAAGTCCGC
TACCGCAAAAAACTCGAAGATGAACGCATAAGGCTTGTGGACCGTGCAATGAAGAATGACCCCAACTTTCGCCCG
CCCGTTGAATATCATCAACAAAAACGATCTCAGAGGCCTTCTGAAAAGGTCTACATCCCAGTTAAAGAGTTTCCA
GAGATCAACTTCTTTGGTTTATTAGTCGGTCCTCGTGGCAATAGTTTGAAGAAGATGGAACGCGACAGCGGTGCT
AAAATTAGTATCCGTGGCAAAGGCAGCGTCAAAGAAGGGAAAGCTCGACCTGATCAATTTGCTGAGGATGCAGAA
GAAGATCTACATTGTCTTGTCATTGCTGACTCTGACGACAAGGTAGCCGCTTGCGTCAAAATGATCAACCGAGTC
ATAGAGACAGTAAGTCGTGTCGTTAGCATTTTTGAAACAATCTGACATTGGTCGAATGACCAGGCGGCTTCTACT
CCGGAAGGTCAAAATGTTCATAAACGTGATCAACTTCGAGAGCTCGCTGCTTTGAACGGTACTCTGCGTGACGAT
GAAAACCAGATTTGTCAAAATTGTGGTGGCATAGGACATCGCAAATATGATTGTCCAGAGCAACGCAACTTTACT
GCTAACATAATCTGTCATGTTTGTGGTAGTGCTGGTCATATGGCGAGGGATTGTACCGTCAACAAAGATCCTAAT
GCGCCGCCCCGCCCGCAGCAACAAATGAGAGGGGGTTTCGATTCTGAATACGCAAGTCTGATGGCCGAGTTAGGT
GAAGGTGCAACTGGCGGCGGGGAAGGAGGAAAAACATGGGGTGGTACTAGTATGGGTCACGACATAACAGCAGGC
GGTTCTAACATCCCCCCCTGGCGTCGCCCCGAAAACTGGCAGCAACCTGCCGCTGCGCAGCAATCACAAGGTTAC
CGACCTCCTCAAGGTTACGGAGCCGGTTACTCAGGTGCTGGCTATGGTGGCGCTGGAGGAAATGCGTATCCCGGT
TACCAGCAAGCTGGTTATCAACAGCCTCAAGACTACTCTAATTATGCCGCTTACTATCAAGGCCAATACGCTCAA
CAACAACCCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail